Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2462
Gene name
LocationContig_222:7550..11853
Strand-
Gene length (bp)4303
Transcript length (bp)4215
Coding sequence length (bp)4215
Protein length (aa) 1405

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07989 Cnn_1N Centrosomin N-terminal motif 1 7.0E-21 353 424

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O60039|APSB_EMENI Anucleate primary sterigmata protein B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=apsB PE=4 SV=2 352 1398 0.0E+00
sp|O94488|MBO1_SCHPO Microtubule organizer protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mbo1 PE=1 SV=1 252 1386 2.0E-31

GO

GO Term Description Terminal node
GO:0005815 microtubule organizing center Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2462
MADADSSHGVVAEQPPKETPRVADEAGSAPEQEPRQLPSPPRDSSQIEATAVDDESLEIDDGVSEEAVRRHLNDV
ESSFLPALSPIASGSAAAVGVDDSYLFDSPEKLPLRQLDAGRPEFDSSPTAAAAARSRNKAAADARKTSAAARED
DDAPRRAPSTTESVEAGPSTGPAASLRPFDQPNKYLRSRNASEVSSTSSFITNPGDSDATAGLGLGLDYALHSGG
AVPSVDSSRAPSYPLPRSASMGSMASAFANDDSDVMAPHQLSPLAEVDSPPQTRQGGDPDKTPKQPSRDGVDSAP
TDTVIARHVKNVEVPESLAKEYKFSGGLQTPRRPPPVTAGGTGTANRGGRSLTLKEQSSTIERLSKENFDLKLKV
MFLSDRLDKLSEEGIRDMISENVDLRTNLAVHQRENKILRKRVKELERKVSDDDNRPSTARSGTSSTGQTSRQDE
EEREEELIYLRERVEKYAVEIERLQDEAVHREAEKRKMAEMVKTMGTRTGDGVGRQEEADVWKDLLEQETARREQ
ADEENRKLREDVFQLKRDISLGGPRPQKYIFKVNKESLERNTSPDNEEGTSAQSAALIEELRREGEQLRHENAEL
RREVGAQTSMLTSRNREKERLYQEIEDLKIAQRRPVVGGSGGVGGSGGGGVAASTVDSILERSASQAGGLERPQS
RGSGKAVQAMVDKDREREELEDQVDEMRDKISEIRLQNHELQRELDSCMTDFETAVGGKRQAEEAAASLREDVDA
VTNDLVSLQAERDEALREQGEMERQFQALRREAQREIDALEAEADERNEEVQRVQAELRDRTENFDALQDEMRKL
SEALVRLEDDQHNKLRRIGQLEGELDSSNQELEELEQKLLEANNKNQRLVVQQESSQGEIGFLREEQEADKMRIG
DMEAALAQAQDSLREEKERARELDTRLQQERVQREMVADREREEVQQLVDELNREVSTSRDENRRLRKNLSSREV
EATEWKERLLELENNLREALGDLNGTRSSLLKADGRVKSKSIANLQRELENTVRDLDTTRASAAEKDRVIKQRDA
LLESHALESRRVAELLDKERVGHRNTKAQFEQFRRTNQHLSQTASSQDVRIAELESSRGQERKRTAVVEQAAREQ
LRERNELLLTLWQRLSSLCGREWTNGNALVDRVAVPSVEVIANRLPGFSKNLLAAVKSFEGMLGSLRARAEAMER
DLQREYRVLEEGLAMRVKKLDRLETLVRNSIMSGDQQPMPARMQQLEDAYRQLKVENATLRTAHEVRSRLARSSV
DVAAGSPSVPRGPGDRDQSRSSRTGRGDRGSRESAATSLTATDPGAFPLQAPSTATGMDVALAGGGEQAPGPSGN
ERRWMLRLRDLEYKLRLEREGRNQDRQAARQRLGSLETEIRDLRDRRRRMSEVD*
Coding >Ophun1|2462
ATGGCTGACGCCGACTCTTCTCACGGCGTCGTAGCCGAGCAGCCTCCCAAGGAAACGCCGAGGGTTGCCGACGAG
GCTGGCTCTGCTCCCGAGCAAGAGCCGCGCCAGCTGCCGTCTCCGCCGCGTGATAGCAGTCAAATCGAGGCGACG
GCAGTGGACGACGAGTCTCTGGAGATTGACGATGGCGTGTCTGAGGAGGCGGTACGCAGACACCTTAACGATGTC
GAGTCCAGCTTTCTGCCTGCTCTGTCGCCCATCGCCTCGGGCTCGGCTGCCGCCGTGGGAGTCGATGATAGCTAC
CTGTTTGACTCGCCAGAGAAGCTTCCGTTGCGCCAGCTCGATGCGGGTCGCCCCGAGTTCGACTCGTCGCCCACG
GCTGCCGCTGCCGCGAGGTCTCGCAACAAGGCTGCTGCCGATGCTAGAAAGACTTCGGCGGCAGCTCGCGAAGAC
GACGACGCACCGAGAAGGGCTCCCTCCACGACCGAGAGCGTCGAAGCAGGGCCCTCCACGGGACCTGCTGCCTCC
CTGCGGCCCTTCGACCAACCGAACAAATATCTCCGCAGCCGGAACGCGAGCGAAGTCTCATCTACCTCGTCCTTC
ATCACCAATCCCGGAGACAGCGACGCCACCGCCGGGCTAGGCCTCGGCCTCGACTACGCTCTACACTCGGGTGGT
GCCGTGCCGAGCGTCGACTCGTCCCGGGCTCCCAGCTACCCGCTTCCTCGGTCGGCCAGCATGGGCAGCATGGCC
TCCGCCTTCGCAAACGACGACTCGGATGTCATGGCTCCCCACCAGCTATCTCCGCTCGCCGAGGTCGACAGCCCG
CCGCAGACGCGTCAGGGCGGGGACCCCGACAAGACGCCCAAGCAGCCCTCAAGAGACGGCGTCGACAGCGCACCC
ACCGACACGGTCATAGCCCGGCACGTCAAGAACGTCGAGGTTCCCGAGTCCCTGGCAAAAGAATACAAGTTCAGC
GGTGGCCTGCAGACACCGCGGAGGCCACCCCCCGTCACCGCAGGCGGCACAGGCACCGCTAACCGCGGTGGTAGG
AGCTTGACGCTCAAAGAGCAGAGCAGCACCATCGAGAGGCTGTCCAAGGAGAACTTTGACCTGAAGCTCAAGGTC
ATGTTCCTCAGTGACCGCCTGGACAAACTCTCGGAGGAGGGCATCCGCGACATGATCTCGGAAAACGTCGACCTC
AGGACCAACCTCGCCGTTCATCAGCGAGAAAACAAGATTCTCAGGAAGAGGGTCAAGGAGTTGGAGCGAAAAGTC
AGCGATGACGACAACCGGCCGAGTACGGCTCGCAGCGGCACGTCCTCGACCGGCCAGACCTCGAGGCAAGACGAA
GAGGAGCGCGAGGAGGAGCTCATCTACCTGCGAGAGCGCGTCGAGAAGTATGCCGTTGAGATTGAGCGTCTACAG
GACGAGGCAGTCCACAGGGAGGCAGAAAAGAGGAAGATGGCGGAGATGGTCAAGACGATGGGCACCCGGACCGGC
GACGGTGTTGGTCGTCAAGAGGAGGCCGACGTCTGGAAGGATCTGCTCGAGCAAGAGACGGCACGTCGAGAGCAG
GCCGACGAGGAGAACCGCAAGCTGCGAGAGGACGTCTTTCAGCTCAAAAGGGACATCTCGTTGGGCGGTCCGCGC
CCGCAAAAGTACATCTTCAAAGTCAACAAGGAGTCGCTCGAACGCAACACGTCTCCCGATAACGAGGAGGGCACC
AGCGCCCAGTCGGCAGCGCTCATCGAGGAGCTCCGGCGCGAAGGCGAGCAGCTGCGGCACGAGAACGCCGAGCTC
CGACGCGAGGTGGGCGCCCAGACGTCGATGCTTACGTCGAGGAATCGCGAAAAGGAGCGACTGTACCAGGAGATT
GAGGACTTGAAGATTGCGCAGCGTCGCCCCGTCGTCGGCGGCAGCGGAGGTGTAGGCGGAAGTGGAGGAGGAGGC
GTGGCCGCGTCGACCGTCGACAGCATCCTCGAGCGATCGGCATCGCAGGCCGGCGGACTTGAGAGGCCCCAGTCA
CGAGGCAGCGGCAAGGCGGTGCAGGCGATGGTGGACAAGGATCGCGAGCGCGAGGAGCTGGAGGATCAAGTGGAC
GAGATGCGCGACAAGATCAGCGAGATCAGGCTCCAGAACCACGAGCTGCAACGCGAGCTCGACTCGTGCATGACG
GACTTTGAGACGGCTGTGGGCGGAAAGCGACAAGCGGAGGAGGCGGCTGCCTCGCTGCGAGAGGACGTCGACGCC
GTTACCAACGACCTGGTGTCACTGCAGGCCGAGAGGGACGAGGCGCTCCGAGAGCAGGGCGAGATGGAGCGGCAG
TTCCAGGCGCTCCGGCGGGAGGCACAGCGCGAGATCGACGCGCTCGAGGCCGAGGCGGACGAGCGCAACGAAGAG
GTGCAGCGGGTTCAGGCGGAGCTGAGGGACCGGACAGAGAACTTTGACGCCTTGCAGGACGAGATGCGCAAGCTT
AGCGAGGCCCTCGTCAGGCTCGAAGATGACCAGCACAACAAGTTGCGGCGGATCGGACAGCTTGAGGGGGAGCTC
GACTCGTCCAACCAGGAGCTGGAGGAGCTGGAGCAGAAGCTGCTCGAGGCCAACAACAAGAACCAGCGGCTCGTG
GTGCAGCAGGAGTCGTCGCAGGGCGAGATCGGCTTCCTCCGGGAGGAGCAGGAGGCCGACAAGATGCGCATCGGC
GACATGGAGGCGGCTCTGGCACAGGCCCAAGACAGCCTGCGGGAGGAGAAGGAGCGGGCGCGCGAACTCGACACT
CGGCTTCAACAAGAACGGGTACAGCGCGAGATGGTGGCGGACCGTGAGAGAGAAGAGGTGCAGCAGCTGGTGGAC
GAGCTGAACCGGGAGGTGTCGACGAGCCGAGACGAGAACCGGCGGCTGCGTAAGAACCTGTCGTCGCGCGAGGTC
GAGGCGACGGAGTGGAAGGAGAGGCTCCTGGAGCTGGAGAACAATCTGCGAGAGGCGCTGGGCGATCTGAACGGG
ACGCGCTCGTCGCTGCTCAAGGCTGACGGGCGAGTCAAATCAAAGTCCATCGCCAATTTGCAACGCGAGCTGGAG
AACACGGTCCGCGACCTGGACACGACGCGGGCGTCGGCGGCGGAGAAGGACCGGGTCATCAAGCAGCGCGACGCC
CTGCTCGAGTCACACGCGCTCGAGAGCCGGCGGGTGGCGGAGCTGCTGGACAAGGAGCGGGTCGGGCACCGAAAC
ACCAAGGCGCAGTTTGAGCAGTTCCGGCGGACGAATCAGCACCTCTCGCAGACGGCCAGCTCGCAGGATGTTCGC
ATCGCCGAGCTGGAGAGCAGCCGGGGCCAGGAGCGCAAGCGAACGGCGGTGGTGGAACAGGCGGCGCGGGAGCAG
CTCCGGGAGCGAAACGAGCTGCTGCTGACGCTGTGGCAGCGGCTCAGCTCGTTGTGTGGGCGCGAGTGGACCAAC
GGCAACGCGCTGGTGGACCGGGTGGCGGTGCCGTCGGTCGAGGTCATCGCCAACCGGCTGCCGGGCTTCTCCAAG
AACCTGCTGGCGGCCGTCAAGTCGTTCGAGGGCATGCTAGGCTCGCTGCGGGCCAGGGCCGAGGCTATGGAGCGC
GACCTGCAGCGCGAGTACCGCGTTCTCGAGGAGGGACTCGCGATGCGGGTCAAGAAGCTGGACCGGCTGGAGACG
CTTGTGCGCAACTCGATCATGAGCGGAGATCAGCAGCCGATGCCGGCGCGGATGCAGCAGCTCGAGGACGCGTAC
CGGCAGCTCAAGGTGGAGAACGCGACTCTCCGGACGGCGCACGAGGTCCGAAGCCGGTTGGCCCGGTCGAGCGTC
GATGTAGCAGCCGGGTCGCCTTCGGTGCCGCGCGGGCCGGGCGATCGGGACCAGAGCCGGTCTTCGCGGACGGGC
CGAGGGGATCGGGGCAGCCGGGAGTCAGCGGCGACTTCGTTGACGGCGACGGACCCGGGCGCGTTCCCGCTGCAG
GCCCCTTCAACGGCCACCGGCATGGACGTGGCCCTGGCTGGGGGCGGAGAACAGGCGCCGGGGCCGAGCGGCAAC
GAACGGCGGTGGATGCTCCGTCTCCGCGATCTCGAGTACAAGCTGCGACTGGAGCGTGAGGGACGTAACCAGGAC
CGTCAGGCTGCACGTCAGAGGCTGGGTTCTCTGGAGACGGAGATTCGGGACCTGCGCGACAGGCGGAGGCGCATG
TCCGAGGTGGACTGA
Transcript >Ophun1|2462
ATGGCTGACGCCGACTCTTCTCACGGCGTCGTAGCCGAGCAGCCTCCCAAGGAAACGCCGAGGGTTGCCGACGAG
GCTGGCTCTGCTCCCGAGCAAGAGCCGCGCCAGCTGCCGTCTCCGCCGCGTGATAGCAGTCAAATCGAGGCGACG
GCAGTGGACGACGAGTCTCTGGAGATTGACGATGGCGTGTCTGAGGAGGCGGTACGCAGACACCTTAACGATGTC
GAGTCCAGCTTTCTGCCTGCTCTGTCGCCCATCGCCTCGGGCTCGGCTGCCGCCGTGGGAGTCGATGATAGCTAC
CTGTTTGACTCGCCAGAGAAGCTTCCGTTGCGCCAGCTCGATGCGGGTCGCCCCGAGTTCGACTCGTCGCCCACG
GCTGCCGCTGCCGCGAGGTCTCGCAACAAGGCTGCTGCCGATGCTAGAAAGACTTCGGCGGCAGCTCGCGAAGAC
GACGACGCACCGAGAAGGGCTCCCTCCACGACCGAGAGCGTCGAAGCAGGGCCCTCCACGGGACCTGCTGCCTCC
CTGCGGCCCTTCGACCAACCGAACAAATATCTCCGCAGCCGGAACGCGAGCGAAGTCTCATCTACCTCGTCCTTC
ATCACCAATCCCGGAGACAGCGACGCCACCGCCGGGCTAGGCCTCGGCCTCGACTACGCTCTACACTCGGGTGGT
GCCGTGCCGAGCGTCGACTCGTCCCGGGCTCCCAGCTACCCGCTTCCTCGGTCGGCCAGCATGGGCAGCATGGCC
TCCGCCTTCGCAAACGACGACTCGGATGTCATGGCTCCCCACCAGCTATCTCCGCTCGCCGAGGTCGACAGCCCG
CCGCAGACGCGTCAGGGCGGGGACCCCGACAAGACGCCCAAGCAGCCCTCAAGAGACGGCGTCGACAGCGCACCC
ACCGACACGGTCATAGCCCGGCACGTCAAGAACGTCGAGGTTCCCGAGTCCCTGGCAAAAGAATACAAGTTCAGC
GGTGGCCTGCAGACACCGCGGAGGCCACCCCCCGTCACCGCAGGCGGCACAGGCACCGCTAACCGCGGTGGTAGG
AGCTTGACGCTCAAAGAGCAGAGCAGCACCATCGAGAGGCTGTCCAAGGAGAACTTTGACCTGAAGCTCAAGGTC
ATGTTCCTCAGTGACCGCCTGGACAAACTCTCGGAGGAGGGCATCCGCGACATGATCTCGGAAAACGTCGACCTC
AGGACCAACCTCGCCGTTCATCAGCGAGAAAACAAGATTCTCAGGAAGAGGGTCAAGGAGTTGGAGCGAAAAGTC
AGCGATGACGACAACCGGCCGAGTACGGCTCGCAGCGGCACGTCCTCGACCGGCCAGACCTCGAGGCAAGACGAA
GAGGAGCGCGAGGAGGAGCTCATCTACCTGCGAGAGCGCGTCGAGAAGTATGCCGTTGAGATTGAGCGTCTACAG
GACGAGGCAGTCCACAGGGAGGCAGAAAAGAGGAAGATGGCGGAGATGGTCAAGACGATGGGCACCCGGACCGGC
GACGGTGTTGGTCGTCAAGAGGAGGCCGACGTCTGGAAGGATCTGCTCGAGCAAGAGACGGCACGTCGAGAGCAG
GCCGACGAGGAGAACCGCAAGCTGCGAGAGGACGTCTTTCAGCTCAAAAGGGACATCTCGTTGGGCGGTCCGCGC
CCGCAAAAGTACATCTTCAAAGTCAACAAGGAGTCGCTCGAACGCAACACGTCTCCCGATAACGAGGAGGGCACC
AGCGCCCAGTCGGCAGCGCTCATCGAGGAGCTCCGGCGCGAAGGCGAGCAGCTGCGGCACGAGAACGCCGAGCTC
CGACGCGAGGTGGGCGCCCAGACGTCGATGCTTACGTCGAGGAATCGCGAAAAGGAGCGACTGTACCAGGAGATT
GAGGACTTGAAGATTGCGCAGCGTCGCCCCGTCGTCGGCGGCAGCGGAGGTGTAGGCGGAAGTGGAGGAGGAGGC
GTGGCCGCGTCGACCGTCGACAGCATCCTCGAGCGATCGGCATCGCAGGCCGGCGGACTTGAGAGGCCCCAGTCA
CGAGGCAGCGGCAAGGCGGTGCAGGCGATGGTGGACAAGGATCGCGAGCGCGAGGAGCTGGAGGATCAAGTGGAC
GAGATGCGCGACAAGATCAGCGAGATCAGGCTCCAGAACCACGAGCTGCAACGCGAGCTCGACTCGTGCATGACG
GACTTTGAGACGGCTGTGGGCGGAAAGCGACAAGCGGAGGAGGCGGCTGCCTCGCTGCGAGAGGACGTCGACGCC
GTTACCAACGACCTGGTGTCACTGCAGGCCGAGAGGGACGAGGCGCTCCGAGAGCAGGGCGAGATGGAGCGGCAG
TTCCAGGCGCTCCGGCGGGAGGCACAGCGCGAGATCGACGCGCTCGAGGCCGAGGCGGACGAGCGCAACGAAGAG
GTGCAGCGGGTTCAGGCGGAGCTGAGGGACCGGACAGAGAACTTTGACGCCTTGCAGGACGAGATGCGCAAGCTT
AGCGAGGCCCTCGTCAGGCTCGAAGATGACCAGCACAACAAGTTGCGGCGGATCGGACAGCTTGAGGGGGAGCTC
GACTCGTCCAACCAGGAGCTGGAGGAGCTGGAGCAGAAGCTGCTCGAGGCCAACAACAAGAACCAGCGGCTCGTG
GTGCAGCAGGAGTCGTCGCAGGGCGAGATCGGCTTCCTCCGGGAGGAGCAGGAGGCCGACAAGATGCGCATCGGC
GACATGGAGGCGGCTCTGGCACAGGCCCAAGACAGCCTGCGGGAGGAGAAGGAGCGGGCGCGCGAACTCGACACT
CGGCTTCAACAAGAACGGGTACAGCGCGAGATGGTGGCGGACCGTGAGAGAGAAGAGGTGCAGCAGCTGGTGGAC
GAGCTGAACCGGGAGGTGTCGACGAGCCGAGACGAGAACCGGCGGCTGCGTAAGAACCTGTCGTCGCGCGAGGTC
GAGGCGACGGAGTGGAAGGAGAGGCTCCTGGAGCTGGAGAACAATCTGCGAGAGGCGCTGGGCGATCTGAACGGG
ACGCGCTCGTCGCTGCTCAAGGCTGACGGGCGAGTCAAATCAAAGTCCATCGCCAATTTGCAACGCGAGCTGGAG
AACACGGTCCGCGACCTGGACACGACGCGGGCGTCGGCGGCGGAGAAGGACCGGGTCATCAAGCAGCGCGACGCC
CTGCTCGAGTCACACGCGCTCGAGAGCCGGCGGGTGGCGGAGCTGCTGGACAAGGAGCGGGTCGGGCACCGAAAC
ACCAAGGCGCAGTTTGAGCAGTTCCGGCGGACGAATCAGCACCTCTCGCAGACGGCCAGCTCGCAGGATGTTCGC
ATCGCCGAGCTGGAGAGCAGCCGGGGCCAGGAGCGCAAGCGAACGGCGGTGGTGGAACAGGCGGCGCGGGAGCAG
CTCCGGGAGCGAAACGAGCTGCTGCTGACGCTGTGGCAGCGGCTCAGCTCGTTGTGTGGGCGCGAGTGGACCAAC
GGCAACGCGCTGGTGGACCGGGTGGCGGTGCCGTCGGTCGAGGTCATCGCCAACCGGCTGCCGGGCTTCTCCAAG
AACCTGCTGGCGGCCGTCAAGTCGTTCGAGGGCATGCTAGGCTCGCTGCGGGCCAGGGCCGAGGCTATGGAGCGC
GACCTGCAGCGCGAGTACCGCGTTCTCGAGGAGGGACTCGCGATGCGGGTCAAGAAGCTGGACCGGCTGGAGACG
CTTGTGCGCAACTCGATCATGAGCGGAGATCAGCAGCCGATGCCGGCGCGGATGCAGCAGCTCGAGGACGCGTAC
CGGCAGCTCAAGGTGGAGAACGCGACTCTCCGGACGGCGCACGAGGTCCGAAGCCGGTTGGCCCGGTCGAGCGTC
GATGTAGCAGCCGGGTCGCCTTCGGTGCCGCGCGGGCCGGGCGATCGGGACCAGAGCCGGTCTTCGCGGACGGGC
CGAGGGGATCGGGGCAGCCGGGAGTCAGCGGCGACTTCGTTGACGGCGACGGACCCGGGCGCGTTCCCGCTGCAG
GCCCCTTCAACGGCCACCGGCATGGACGTGGCCCTGGCTGGGGGCGGAGAACAGGCGCCGGGGCCGAGCGGCAAC
GAACGGCGGTGGATGCTCCGTCTCCGCGATCTCGAGTACAAGCTGCGACTGGAGCGTGAGGGACGTAACCAGGAC
CGTCAGGCTGCACGTCAGAGGCTGGGTTCTCTGGAGACGGAGATTCGGGACCTGCGCGACAGGCGGAGGCGCATG
TCCGAGGTGGACTGA
Gene >Ophun1|2462
ATGGCTGACGCCGACTCTTCTCACGGCGTCGTAGCCGAGCAGCCTCCCAAGGAAACGCCGAGGGTTGCCGACGAG
GCTGGCTCTGCTCCCGAGCAAGAGCCGCGCCAGCTGCCGTCTCCGCCGCGTGATAGCAGTCAAATCGAGGCGACG
GCAGTGGACGACGAGTCTCTGGAGATTGACGATGGCGTGTCTGAGGAGGCGGTACGCAGACACCTTAACGATGTC
GAGTCCAGCTTTCTGCCTGCTCTGTCGCCCATCGCCTCGGGCTCGGCTGCCGCCGTGGGAGTCGATGATAGCTAC
CTGTTTGACTCGCCAGAGAAGCTTCCGTTGCGCCAGCTCGATGCGGGTCGCCCCGAGTTCGACTCGTCGCCCACG
GCTGCCGCTGCCGCGAGGTCTCGCAACAAGGCTGCTGCCGATGCTAGAAAGACTTCGGCGGCAGCTCGCGAAGAC
GACGACGCACCGAGAAGGGCTCCCTCCACGACCGAGAGCGTCGAAGCAGGGCCCTCCACGGGACCTGCTGCCTCC
CTGCGGCCCTTCGACCAACCGAACAAATATCTCCGCAGCCGGAACGCGAGCGAAGTCTCATCTACCTCGTCCTTC
ATCACCAATCCCGGAGACAGCGACGCCACCGCCGGGCTAGGCCTCGGCCTCGACTACGCTCTACACTCGGGTGGT
GCCGTGCCGAGCGTCGACTCGTCCCGGGCTCCCAGCTACCCGCTTCCTCGGTCGGCCAGCATGGGCAGCATGGCC
TCCGCCTTCGCAAACGACGACTCGGATGTCATGGCTCCCCACCAGCTATCTCCGCTCGCCGAGGTCGACAGCCCG
CCGCAGACGCGTCAGGGCGGGGACCCCGACAAGACGCCCAAGCAGCCCTCAAGAGACGGCGTCGACAGCGCACCC
ACCGACACGGTCATAGCCCGGCACGTCAAGAACGTCGAGGTTCCCGAGTCCCTGGCAAAAGAATACAAGTTCAGC
GGTGGCCTGCAGACACCGCGGAGGCCACCCCCCGTCACCGCAGGCGGCACAGGCACCGCTAACCGCGGTGGTAGG
AGCTTGACGCTCAAAGAGCAGAGCAGCACCATCGAGAGGCTGTCCAAGGAGAACTTTGACCTGAAGCTCAAGGTC
ATGTTCCTCAGTGACCGCCTGGACAAACTCTCGGAGGAGGGCATCCGCGACATGATCTCGGAAAACGTCGACCTC
AGGACCAACCTCGCCGTTCATCAGCGAGAAAACAAGATTCTCAGGAAGAGGGTCAAGGAGTTGGAGCGAAAAGTC
AGCGATGACGACAACCGGCCGAGTACGGCTCGCAGCGGCACGTCCTCGACCGGCCAGACCTCGAGGCAAGACGAA
GAGGAGCGCGAGGAGGAGCTCATCTACCTGCGAGAGCGCGTCGAGAAGTATGCCGTTGAGATTGAGCGTCTACAG
GACGAGGCAGTCCACAGGGAGGCAGAAAAGAGGAAGATGGCGGAGATGGTCAAGACGATGGGCACCCGGACCGGC
GACGGTGTTGGTCGTCAAGAGGAGGCCGACGTCTGGAAGGATCTGCTCGAGCAAGAGACGGCACGTCGAGAGCAG
GCCGACGAGGAGAACCGCAAGCTGCGAGAGGACGTCTTTCAGCTCAAAAGGGACATCTCGTTGGGCGGTCCGCGC
CCGCAAAAGTACATCTTCAAAGTCAACAAGGAGTCGCTCGAACGCAACACGTCTCCCGATAACGAGGAGGGCACC
AGCGCCCAGTCGGCAGCGCTCATCGAGGAGCTCCGGCGCGAAGGCGAGCAGCTGCGGCACGAGAACGCCGAGCTC
CGACGCGAGGTGGGCGCCCAGACGTCGATGCTTACGTCGAGGAATCGCGAAAAGGAGCGACTGTACCAGGAGATT
GAGGACTTGAAGATTGCGCAGCGTCGCCCCGTCGTCGGCGGCAGCGGAGGTGTAGGCGGAAGTGGAGGAGGAGGC
GTGGCCGCGTCGACCGTCGACAGCATCCTCGAGCGATCGGCATCGCAGGCCGGCGGACTTGAGAGGCCCCAGTCA
CGAGGCAGCGGCAAGGCGGTGCAGGCGATGGTGGACAAGGATCGCGAGCGCGAGGAGCTGGAGGATCAAGTGGAC
GAGATGCGCGACAAGATCAGCGAGATCAGGCTCCAGAACCACGAGCTGCAACGCGAGCTCGACTCGTGCATGACG
GACTTTGAGACGGCTGTGGGCGGAAAGCGACAAGCGGAGGAGGCGGCTGCCTCGCTGCGAGAGGACGTCGACGCC
GTTACCAACGACCTGGTGTCACTGCAGGCCGAGAGGGACGAGGCGCTCCGAGAGCAGGGCGAGATGGAGCGGCAG
TTCCAGGCGCTCCGGCGGGAGGCACAGCGCGAGATCGACGCGCTCGAGGCCGAGGCGGACGAGCGCAACGAAGAG
GTGCAGCGGGTTCAGGCGGAGCTGAGGGACCGGACAGAGAACTTTGACGCCTTGCAGGACGAGATGCGCAAGCTT
AGCGAGGCCCTCGTCAGGCTCGAAGATGACCAGCACAACAAGTTGCGGCGGATCGGACAGCTTGAGGGGGAGCTC
GACTCGTCCAACCAGGAGCTGGAGGAGCTGGAGCAGAAGCTGCTCGAGGCCAACAACAAGAACCAGCGGCTCGTG
GTGCAGCAGGAGTCGTCGCAGGGCGAGATCGGCTTCCTCCGGGAGGAGCAGGAGGCCGACAAGATGCGCATCGGC
GACATGGAGGCGGCTCTGGCACAGGCCCAAGACAGCCTGCGGGAGGAGAAGGAGCGGGCGCGCGAACTCGACACT
CGGCTTCAACAAGAACGGGTACAGCGCGAGATGGTGGCGGACCGTGAGAGAGAAGAGGTGCAGCAGCTGGTGGAC
GAGCTGAACCGGGAGGTGTCGACGAGCCGAGACGAGAACCGGCGGCTGCGTAAGAACCTGTCGTCGCGCGAGGTC
GAGGCGACGGAGTGGAAGGAGAGGCTCCTGGAGCTGGAGAACAATCTGCGAGAGGCGCTGGGCGATCTGAACGGG
ACGCGCTCGTCGCTGCTCAAGGTATCCCTTTACCCCTTTCTATCCCTTTTTCACTTTCTGCGTGTTTCTGTTCAC
TCTCCCTTCCCTTGCTGTGATCGATCGCCCTTAGGCTGACGGGCGAGTCAAATCAAAGTCCATCGCCAATTTGCA
ACGCGAGCTGGAGAACACGGTCCGCGACCTGGACACGACGCGGGCGTCGGCGGCGGAGAAGGACCGGGTCATCAA
GCAGCGCGACGCCCTGCTCGAGTCACACGCGCTCGAGAGCCGGCGGGTGGCGGAGCTGCTGGACAAGGAGCGGGT
CGGGCACCGAAACACCAAGGCGCAGTTTGAGCAGTTCCGGCGGACGAATCAGCACCTCTCGCAGACGGCCAGCTC
GCAGGATGTTCGCATCGCCGAGCTGGAGAGCAGCCGGGGCCAGGAGCGCAAGCGAACGGCGGTGGTGGAACAGGC
GGCGCGGGAGCAGCTCCGGGAGCGAAACGAGCTGCTGCTGACGCTGTGGCAGCGGCTCAGCTCGTTGTGTGGGCG
CGAGTGGACCAACGGCAACGCGCTGGTGGACCGGGTGGCGGTGCCGTCGGTCGAGGTCATCGCCAACCGGCTGCC
GGGCTTCTCCAAGAACCTGCTGGCGGCCGTCAAGTCGTTCGAGGGCATGCTAGGCTCGCTGCGGGCCAGGGCCGA
GGCTATGGAGCGCGACCTGCAGCGCGAGTACCGCGTTCTCGAGGAGGGACTCGCGATGCGGGTCAAGAAGCTGGA
CCGGCTGGAGACGCTTGTGCGCAACTCGATCATGAGCGGAGATCAGCAGCCGATGCCGGCGCGGATGCAGCAGCT
CGAGGACGCGTACCGGCAGCTCAAGGTGGAGAACGCGACTCTCCGGACGGCGCACGAGGTCCGAAGCCGGTTGGC
CCGGTCGAGCGTCGATGTAGCAGCCGGGTCGCCTTCGGTGCCGCGCGGGCCGGGCGATCGGGACCAGAGCCGGTC
TTCGCGGACGGGCCGAGGGGATCGGGGCAGCCGGGAGTCAGCGGCGACTTCGTTGACGGCGACGGACCCGGGCGC
GTTCCCGCTGCAGGCCCCTTCAACGGCCACCGGCATGGACGTGGCCCTGGCTGGGGGCGGAGAACAGGCGCCGGG
GCCGAGCGGCAACGAACGGCGGTGGATGCTCCGTCTCCGCGATCTCGAGTACAAGCTGCGACTGGAGCGTGAGGG
ACGTAACCAGGACCGTCAGGCTGCACGTCAGAGGCTGGGTTCTCTGGAGACGGAGATTCGGGACCTGCGCGACAG
GCGGAGGCGCATGTCCGAGGTGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail