Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2454
Gene name
LocationContig_221:16331..21300
Strand+
Gene length (bp)4969
Transcript length (bp)4566
Coding sequence length (bp)4566
Protein length (aa) 1522

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 3.6E-23 27 291
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 1.4E-06 26 235

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UVG6|VPS15_PICPA Putative serine/threonine-protein kinase VPS15 OS=Komagataella pastoris GN=VPS15 PE=3 SV=3 1 939 3.0E-172
sp|P22219|VPS15_YEAST Serine/threonine-protein kinase VPS15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS15 PE=1 SV=4 1 897 3.0E-154
sp|Q99570|PI3R4_HUMAN Phosphoinositide 3-kinase regulatory subunit 4 OS=Homo sapiens GN=PIK3R4 PE=1 SV=3 20 881 1.0E-149
sp|Q8VD65|PI3R4_MOUSE Phosphoinositide 3-kinase regulatory subunit 4 OS=Mus musculus GN=Pik3r4 PE=1 SV=3 20 881 1.0E-144
sp|P0C0R5|PI3R4_RAT Phosphoinositide 3-kinase regulatory subunit 4 OS=Rattus norvegicus GN=Pik3r4 PE=3 SV=2 20 881 2.0E-144
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UVG6|VPS15_PICPA Putative serine/threonine-protein kinase VPS15 OS=Komagataella pastoris GN=VPS15 PE=3 SV=3 1 939 3.0E-172
sp|P22219|VPS15_YEAST Serine/threonine-protein kinase VPS15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS15 PE=1 SV=4 1 897 3.0E-154
sp|Q99570|PI3R4_HUMAN Phosphoinositide 3-kinase regulatory subunit 4 OS=Homo sapiens GN=PIK3R4 PE=1 SV=3 20 881 1.0E-149
sp|Q8VD65|PI3R4_MOUSE Phosphoinositide 3-kinase regulatory subunit 4 OS=Mus musculus GN=Pik3r4 PE=1 SV=3 20 881 1.0E-144
sp|P0C0R5|PI3R4_RAT Phosphoinositide 3-kinase regulatory subunit 4 OS=Rattus norvegicus GN=Pik3r4 PE=3 SV=2 20 881 2.0E-144
sp|Q5R9I3|PI3R4_PONAB Phosphoinositide 3-kinase regulatory subunit 4 OS=Pongo abelii GN=PIK3R4 PE=2 SV=3 20 881 6.0E-143
sp|O42900|PPK19_SCHPO Serine/threonine-protein kinase ppk19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk19 PE=1 SV=1 21 844 2.0E-141
sp|Q54S77|VPS15_DICDI Probable serine/threonine-protein kinase vps15 OS=Dictyostelium discoideum GN=vps15 PE=3 SV=1 25 347 5.0E-78
sp|Q54S77|VPS15_DICDI Probable serine/threonine-protein kinase vps15 OS=Dictyostelium discoideum GN=vps15 PE=3 SV=1 397 769 1.0E-45
sp|Q9UVG6|VPS15_PICPA Putative serine/threonine-protein kinase VPS15 OS=Komagataella pastoris GN=VPS15 PE=3 SV=3 1036 1438 8.0E-39
sp|P0C0R5|PI3R4_RAT Phosphoinositide 3-kinase regulatory subunit 4 OS=Rattus norvegicus GN=Pik3r4 PE=3 SV=2 1100 1453 3.0E-36
sp|Q8VD65|PI3R4_MOUSE Phosphoinositide 3-kinase regulatory subunit 4 OS=Mus musculus GN=Pik3r4 PE=1 SV=3 1100 1453 4.0E-36
sp|Q99570|PI3R4_HUMAN Phosphoinositide 3-kinase regulatory subunit 4 OS=Homo sapiens GN=PIK3R4 PE=1 SV=3 1100 1453 6.0E-36
sp|Q54S77|VPS15_DICDI Probable serine/threonine-protein kinase vps15 OS=Dictyostelium discoideum GN=vps15 PE=3 SV=1 1108 1359 9.0E-36
sp|Q5R9I3|PI3R4_PONAB Phosphoinositide 3-kinase regulatory subunit 4 OS=Pongo abelii GN=PIK3R4 PE=2 SV=3 1100 1453 2.0E-34
sp|P22219|VPS15_YEAST Serine/threonine-protein kinase VPS15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS15 PE=1 SV=4 1011 1371 2.0E-31
sp|O42900|PPK19_SCHPO Serine/threonine-protein kinase ppk19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk19 PE=1 SV=1 1043 1344 7.0E-24
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 29 291 7.0E-12
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 26 297 1.0E-10
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 28 337 2.0E-10
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 26 288 2.0E-10
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 13 291 3.0E-10
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 26 234 4.0E-10
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 23 287 5.0E-10
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 18 291 1.0E-09
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 18 291 1.0E-09
sp|Q626B1|PMY13_CAEBR Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 OS=Caenorhabditis briggsae GN=wee-1.3 PE=3 SV=1 7 297 1.0E-09
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 28 337 1.0E-09
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 18 291 1.0E-09
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 29 283 2.0E-09
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 30 303 2.0E-09
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 26 202 3.0E-09
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 21 290 3.0E-09
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 30 303 4.0E-09
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 21 290 4.0E-09
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 30 303 4.0E-09
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 30 303 4.0E-09
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 29 291 5.0E-09
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 30 303 6.0E-09
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 29 291 6.0E-09
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 20 235 6.0E-09
sp|Q8BHI9|NIM1_MOUSE Serine/threonine-protein kinase NIM1 OS=Mus musculus GN=Nim1k PE=2 SV=1 31 168 7.0E-09
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 29 292 8.0E-09
sp|Q8IY84|NIM1_HUMAN Serine/threonine-protein kinase NIM1 OS=Homo sapiens GN=NIM1K PE=1 SV=1 31 168 1.0E-08
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 28 315 1.0E-08
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 29 285 1.0E-08
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 21 290 2.0E-08
sp|Q54DF2|MRKA_DICDI Probable serine/threonine-protein kinase MARK-A OS=Dictyostelium discoideum GN=mrkA PE=3 SV=1 29 291 2.0E-08
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 1 291 2.0E-08
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 29 291 2.0E-08
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 26 202 3.0E-08
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 29 230 3.0E-08
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 26 202 3.0E-08
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 29 291 3.0E-08
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 29 291 4.0E-08
sp|Q5REX1|SIK2_PONAB Serine/threonine-protein kinase SIK2 OS=Pongo abelii GN=SIK2 PE=2 SV=1 28 169 4.0E-08
sp|Q75GK4|CIPK7_ORYSJ CBL-interacting protein kinase 7 OS=Oryza sativa subsp. japonica GN=CIPK7 PE=2 SV=1 26 181 4.0E-08
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 85 310 5.0E-08
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 29 300 5.0E-08
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 29 348 6.0E-08
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 26 187 6.0E-08
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 26 230 1.0E-07
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 28 168 1.0E-07
sp|Q3TZA2|CDKL4_MOUSE Cyclin-dependent kinase-like 4 OS=Mus musculus GN=Cdkl4 PE=2 SV=1 26 234 1.0E-07
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 81 299 1.0E-07
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 28 288 1.0E-07
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 11 249 1.0E-07
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 11 249 2.0E-07
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 29 291 2.0E-07
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 26 202 2.0E-07
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 85 302 2.0E-07
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 19 293 2.0E-07
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 26 315 2.0E-07
sp|P16892|FUS3_YEAST Mitogen-activated protein kinase FUS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUS3 PE=1 SV=2 83 240 2.0E-07
sp|O80902|CIPKM_ARATH CBL-interacting serine/threonine-protein kinase 22 OS=Arabidopsis thaliana GN=CIPK22 PE=2 SV=1 31 230 2.0E-07
sp|Q940H6|SRK2E_ARATH Serine/threonine-protein kinase SRK2E OS=Arabidopsis thaliana GN=SRK2E PE=1 SV=1 12 299 2.0E-07
sp|Q6C7U8|PHO85_YARLI Negative regulator of the PHO system OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PHO85 PE=3 SV=1 86 240 2.0E-07
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 19 288 2.0E-07
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 11 249 3.0E-07
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 22 283 3.0E-07
sp|Q4R7T5|CDKL2_MACFA Cyclin-dependent kinase-like 2 OS=Macaca fascicularis GN=CDKL2 PE=2 SV=1 31 337 3.0E-07
sp|Q8C1R0|TSSK5_MOUSE Testis-specific serine/threonine-protein kinase 5 OS=Mus musculus GN=Tssk5 PE=2 SV=2 1 171 3.0E-07
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 85 299 3.0E-07
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 26 202 3.0E-07
sp|A2KF29|SMKTR_MOUSE Sperm motility kinase Tcr mutant form OS=Mus musculus GN=Smoktcr PE=2 SV=1 26 290 3.0E-07
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 31 168 4.0E-07
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 26 298 4.0E-07
sp|Q5R754|CDKL2_PONAB Cyclin-dependent kinase-like 2 OS=Pongo abelii GN=CDKL2 PE=2 SV=1 31 337 5.0E-07
sp|C4YGK0|ERK1_CANAW Extracellular signal-regulated kinase 1 OS=Candida albicans (strain WO-1) GN=CEK1 PE=3 SV=1 83 240 5.0E-07
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 85 291 5.0E-07
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 14 296 5.0E-07
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 25 230 5.0E-07
sp|Q9URT9|GSK31_SCHPO Protein kinase gsk31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gsk31 PE=1 SV=1 97 270 5.0E-07
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 29 291 5.0E-07
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 26 295 6.0E-07
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 26 202 7.0E-07
sp|Q92772|CDKL2_HUMAN Cyclin-dependent kinase-like 2 OS=Homo sapiens GN=CDKL2 PE=1 SV=1 31 337 8.0E-07
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 81 283 8.0E-07
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 26 300 9.0E-07
sp|Q5A1D3|ERK1_CANAL Extracellular signal-regulated kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CEK1 PE=1 SV=2 83 240 9.0E-07
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 22 285 9.0E-07
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 30 303 1.0E-06
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 29 291 1.0E-06
sp|Q9WTU6|MK09_MOUSE Mitogen-activated protein kinase 9 OS=Mus musculus GN=Mapk9 PE=1 SV=2 49 312 1.0E-06
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 30 303 1.0E-06
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 26 285 1.0E-06
sp|Q6AXJ9|CDKL1_DANRE Cyclin-dependent kinase-like 1 OS=Danio rerio GN=cdkl1 PE=2 SV=1 26 260 1.0E-06
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 30 303 1.0E-06
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 30 303 1.0E-06
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 29 291 1.0E-06
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 26 247 1.0E-06
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 26 295 1.0E-06
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 14 296 1.0E-06
sp|Q9TTK0|CDKL2_RABIT Cyclin-dependent kinase-like 2 OS=Oryctolagus cuniculus GN=CDKL2 PE=2 SV=1 31 240 1.0E-06
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 26 202 1.0E-06
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 29 291 2.0E-06
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 85 283 2.0E-06
sp|Q5N942|SAPK4_ORYSJ Serine/threonine-protein kinase SAPK4 OS=Oryza sativa subsp. japonica GN=SAPK4 PE=2 SV=2 26 157 2.0E-06
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 85 291 2.0E-06
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 86 291 2.0E-06
sp|Q8C0N0|SMKZ_MOUSE Sperm motility kinase Z OS=Mus musculus GN=Gm4922 PE=2 SV=1 85 168 2.0E-06
sp|Q5MAI5|CDKL4_HUMAN Cyclin-dependent kinase-like 4 OS=Homo sapiens GN=CDKL4 PE=2 SV=2 53 234 2.0E-06
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 29 230 2.0E-06
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 85 318 2.0E-06
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 26 230 2.0E-06
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 14 296 3.0E-06
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 85 291 3.0E-06
sp|B1WAS2|HUNK_XENTR Hormonally up-regulated neu tumor-associated kinase homolog OS=Xenopus tropicalis GN=hunk PE=2 SV=1 85 290 3.0E-06
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 44 291 3.0E-06
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 85 335 4.0E-06
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 58 297 4.0E-06
sp|Q5XHI9|HUNKA_XENLA Hormonally up-regulated neu tumor-associated kinase homolog A OS=Xenopus laevis GN=hunk-a PE=2 SV=1 85 290 5.0E-06
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 1 283 6.0E-06
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 29 300 6.0E-06
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 11 288 6.0E-06
sp|O64812|SRK2J_ARATH Serine/threonine-protein kinase SRK2J OS=Arabidopsis thaliana GN=SRK2J PE=1 SV=1 31 204 7.0E-06
sp|Q54PX0|Y4251_DICDI Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum GN=DDB_G0284251 PE=3 SV=1 31 338 7.0E-06
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 85 291 7.0E-06
sp|O18209|PMY13_CAEEL Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 OS=Caenorhabditis elegans GN=wee-1.3 PE=1 SV=1 23 296 7.0E-06
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 26 168 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2454
MGQGFSLATPSAGSASIDVAQLQDVQYERSIGNGRFMKSIRGRHENGVVLVKVLVKPFAEVKLDEYKRQIISQTS
PGRKALANVPNALAFQRIIETETNGYLVRQYQYSSLYDRLSTRPFLEEIEKKWLAFQLLCALRDCHARDVYHGDI
KAQNVLVTSWNWLYLTDFSSAFKPILLPDDNPADFSYFFDTSGRRTCYIAPERFYVVGENPPPKAEMTWAMDVFS
AGCVIAQMFLESELFSLAQLFKYRRGEHDPVATQLSVISDREVREMIAHMIQVDPEKRYSADQYLQFWKVKVFPP
YFYSFLHQYMEHITDPSSGISPMSGSQKNMGESDDRIDRVFGDFDKISYFLGYQPEKRTATAVLPPARLGLGHFP
VRLSLANHNLPVSADLEPPEDDGTLIFLSLIVSSLRTTARASSRVRACDILLAFAERLTDEAKLDRVLPYLVTLL
RWDEADIVVVSAIRTITQLLQLVRMPTPINSHVLVEYVLPRMEMALGSRFRASSPLVRATYASCIGSLASTGQRF
LEIASSLRADGSMPIADPEVEPGLDAEANLESVFDTAGRELFEILESHTKQLVEDPDVYVRRAFLTSVPELCMFF
QEHSNEILLTHLNTYFNDRDWTLKCAFFDAVVGITTFIGSTSLEEFMLPLIVQALADPEEFVVQAAMHSLAQLAG
LGLLSRPKLWELADVAGRLTMHPNMWIREAAAEFLAMSARFLDTADVRCILMPLLKPYLKVPCLVDVSELGILDC
LKKPLTRAVFDQAIAWASQADRGVFWKSLKRVRSLSFGQSGGLSAPSQDPSISSLAKAARNEEDRQWLEKLRKLG
LKPEDEPKLIALREYIWRTCKAKPPPVPPPTTTTSEAVLPTGLVSLKALGVTPQTVFFDDAPLTDSSAAAPDLGS
PPGPYTIAEALLDASMTLGDSAARKRQTAFNSHGNRVHSVGPRLSRATRRALSPGGSERGSSVRPRGESPMSRVG
GPGDEELLIRDGLYSVRRNVRHQASALSLLDRKDGNKSIAETATSDANAFGEVEGPFIQPSPESARDIDERRAAS
RQSRHSYEGTDPNIQRMLDRMYIENFPRDVLEFGPMVTPIAGGKLRMLNPEPGSGGQWRPEGHLVATFAEHKGPV
NRVVASPDHVFFITGGSDGSVRVWDTARLERNITHRSRQTHRHADGARVTALCFVEKTHCFVSCASDGSVQVVKV
DTVSASGVLRYGKLRVVRDHRLPEGEVAVWCEHFRQESASVLILATSRSRVLGMDLRTMTVLYELENPVHHGTPT
CSCVDKKRNWLCLGTSHGVIDLWDLRFKMRLKAWGIPGKAAIHRMSIHPAKGRGKWVCVTGGTCHGEVTVWDLEK
TTCREIYRSSGSKDSAKNYVPWDVDEDRPEGMLARFATDLESNDGGVHAMVVGTGASEDSRDVRHAYIATGGSDR
KLRFWDVTRIENSCVYSGLQPEEAVPTYGATNPTTGLTLNAERTSSASTRSKGSAGSRPPRSTVISMQQQQLLQS
HMDAVLDLAVLEYPYTMSVRD*
Coding >Ophun1|2454
ATGGGCCAGGGCTTCTCTCTCGCGACGCCGTCCGCCGGCTCGGCCAGCATCGACGTTGCGCAGCTTCAGGACGTG
CAGTACGAGAGGAGCATCGGTAATGGCCGCTTCATGAAGAGTATCCGAGGCCGCCACGAGAACGGCGTCGTGCTC
GTCAAGGTGCTGGTCAAGCCCTTTGCCGAGGTCAAGCTCGACGAGTACAAGCGGCAGATCATAAGTCAGACGTCT
CCCGGCCGCAAGGCCCTGGCCAATGTCCCCAACGCTCTCGCTTTCCAGCGTATCATCGAGACGGAGACCAACGGC
TACCTCGTGAGGCAGTATCAGTACAGCTCTCTCTACGATCGCCTCAGCACTCGCCCTTTTCTCGAGGAGATTGAG
AAGAAATGGCTCGCTTTTCAGCTTCTGTGTGCTCTGCGAGACTGTCATGCCCGCGATGTCTACCACGGCGACATC
AAGGCGCAGAATGTCCTCGTCACGTCTTGGAACTGGCTGTATCTGACAGACTTTTCCTCGGCCTTTAAACCCATC
CTGCTTCCCGACGACAATCCTGCCGATTTCTCCTACTTCTTCGACACGTCGGGCCGGCGTACGTGCTATATTGCG
CCTGAGCGCTTCTATGTCGTTGGCGAGAACCCTCCGCCCAAGGCTGAGATGACGTGGGCCATGGACGTCTTCAGC
GCCGGCTGTGTCATTGCTCAGATGTTCTTGGAGTCGGAGCTCTTCAGTCTCGCTCAGCTATTCAAATATCGCCGT
GGCGAGCACGATCCCGTCGCGACACAACTAAGCGTCATTTCAGACCGGGAGGTCCGCGAAATGATCGCTCACATG
ATTCAGGTCGATCCCGAGAAGCGCTACTCGGCCGACCAATATCTGCAGTTCTGGAAAGTCAAAGTGTTCCCGCCT
TACTTCTACAGCTTTCTTCATCAGTACATGGAGCACATCACCGACCCATCCTCGGGTATCAGTCCCATGTCTGGC
TCACAGAAGAACATGGGGGAGTCCGACGACCGCATAGATCGCGTCTTCGGCGACTTTGACAAGATTTCCTATTTT
CTCGGCTATCAACCCGAGAAGCGGACGGCGACGGCAGTGCTACCGCCTGCGCGTTTAGGCCTTGGACACTTTCCC
GTCCGACTGAGCCTCGCCAACCATAACTTGCCTGTTTCGGCAGATCTCGAACCGCCGGAAGACGACGGCACCCTC
ATTTTTCTCAGCCTCATTGTCTCCTCACTGAGGACCACTGCTCGTGCCTCTTCGAGGGTTCGAGCGTGCGACATC
CTGCTTGCGTTTGCCGAGAGGCTCACGGATGAGGCCAAGCTAGATCGAGTATTGCCGTATCTGGTGACGCTCCTG
CGCTGGGACGAGGCCGACATCGTCGTCGTATCCGCTATCCGGACCATCACCCAGCTTCTACAGCTCGTCCGCATG
CCGACACCGATCAACTCTCACGTCCTAGTGGAATACGTGCTGCCGCGGATGGAAATGGCCCTCGGATCGAGGTTC
CGGGCTTCGAGTCCGCTGGTGAGGGCGACCTACGCCTCGTGTATTGGAAGCTTGGCCTCGACCGGGCAGCGCTTT
CTCGAGATAGCCTCGAGTCTCAGGGCGGACGGCTCCATGCCAATTGCAGACCCGGAAGTCGAGCCCGGCCTCGAC
GCCGAGGCCAACCTTGAGAGCGTCTTCGACACGGCTGGCAGGGAGCTATTCGAGATATTGGAGAGCCACACCAAG
CAGCTTGTTGAGGATCCGGACGTCTACGTGCGCCGGGCTTTCCTGACTTCGGTCCCGGAGCTGTGCATGTTCTTC
CAAGAGCACTCTAACGAGATCCTACTGACGCACCTCAACACGTACTTCAACGACCGCGACTGGACGCTCAAGTGT
GCTTTCTTCGACGCCGTGGTGGGCATCACAACTTTTATCGGGAGCACCAGCCTCGAGGAGTTTATGCTCCCCCTC
ATTGTTCAGGCTCTAGCGGACCCGGAGGAGTTTGTGGTGCAGGCCGCGATGCATTCGCTCGCGCAGCTCGCCGGT
CTGGGCCTCCTGTCGAGACCGAAGCTGTGGGAGCTGGCTGATGTCGCTGGAAGACTGACGATGCATCCGAATATG
TGGATACGGGAGGCGGCTGCCGAGTTTCTGGCAATGTCGGCCAGGTTCTTGGACACGGCCGATGTGAGATGCATA
CTGATGCCGCTGTTGAAGCCGTACCTAAAGGTCCCTTGCCTCGTGGACGTCTCGGAGCTCGGCATCTTGGACTGT
CTGAAGAAGCCGCTCACGCGAGCGGTGTTTGACCAAGCCATCGCCTGGGCATCGCAGGCCGATCGCGGCGTCTTC
TGGAAGTCCCTGAAGAGGGTACGATCTCTGTCCTTCGGGCAGTCGGGCGGACTTTCGGCGCCTTCGCAAGACCCG
AGCATTAGTTCGCTGGCCAAGGCTGCTCGCAATGAGGAGGACAGGCAGTGGCTTGAGAAGCTGAGAAAACTTGGG
CTCAAGCCAGAGGATGAACCCAAGCTCATCGCTCTCCGAGAGTATATATGGCGAACGTGCAAGGCCAAGCCACCA
CCGGTGCCACCGCCGACGACGACGACCAGTGAAGCGGTTTTGCCGACGGGGCTCGTCTCACTCAAGGCCCTAGGT
GTGACGCCGCAGACGGTTTTCTTCGACGACGCGCCTCTGACGGATTCCTCGGCCGCTGCCCCGGACCTCGGCTCA
CCTCCCGGGCCGTATACCATTGCCGAGGCGCTGCTAGACGCTTCTATGACTCTCGGAGACTCGGCTGCCAGGAAG
AGGCAGACGGCGTTCAACAGCCACGGGAACAGGGTGCACAGCGTCGGTCCTCGTCTTTCAAGAGCGACGAGGCGC
GCCTTGTCTCCAGGGGGAAGCGAGCGGGGAAGTTCGGTGCGGCCGAGAGGAGAGTCACCGATGAGCCGAGTAGGC
GGACCAGGAGATGAGGAGCTACTGATCCGGGACGGCCTCTACTCGGTCAGGAGAAACGTGCGGCATCAAGCCAGT
GCGCTGAGTCTCCTCGACCGCAAGGACGGCAATAAGTCGATCGCGGAGACGGCCACCAGTGACGCCAATGCGTTC
GGAGAGGTCGAGGGGCCCTTTATCCAGCCGTCGCCAGAGTCGGCGCGAGACATCGATGAGCGTCGGGCAGCCTCG
AGGCAGTCGAGACACAGCTACGAGGGGACCGACCCCAATATCCAGAGGATGCTCGACAGGATGTATATTGAAAAC
TTTCCCCGCGACGTGCTGGAGTTTGGCCCAATGGTGACGCCCATCGCCGGTGGCAAGCTCCGGATGCTCAACCCC
GAGCCCGGCTCCGGCGGCCAGTGGCGACCGGAAGGACACCTCGTGGCGACGTTTGCGGAGCACAAGGGCCCCGTC
AACAGGGTCGTCGCCTCTCCGGATCACGTCTTCTTCATCACGGGCGGCAGCGACGGCAGCGTGCGAGTCTGGGAC
ACGGCTAGACTGGAGCGAAACATCACTCACCGGTCGAGACAGACGCACCGTCACGCCGATGGCGCGCGTGTGACG
GCGCTTTGCTTCGTCGAGAAGACGCACTGCTTCGTGAGCTGCGCGAGCGACGGCAGCGTCCAGGTTGTCAAGGTC
GATACCGTCTCGGCCAGTGGCGTCCTTCGCTACGGAAAGCTGCGTGTTGTGCGCGATCATCGGCTGCCCGAGGGC
GAGGTGGCCGTCTGGTGCGAGCACTTCCGGCAGGAGTCGGCATCGGTTCTCATTCTGGCGACAAGCCGATCACGG
GTGCTGGGTATGGACCTGCGGACCATGACGGTACTGTACGAGCTGGAGAACCCGGTCCATCACGGGACGCCGACG
TGTTCTTGCGTCGACAAGAAGCGTAACTGGTTATGTCTGGGCACTTCTCATGGCGTCATCGACCTCTGGGACCTG
CGCTTCAAGATGAGGCTCAAGGCGTGGGGCATCCCTGGCAAGGCGGCCATTCACCGGATGAGCATCCATCCGGCC
AAGGGCCGCGGCAAGTGGGTGTGCGTTACGGGTGGGACGTGCCACGGCGAGGTGACGGTCTGGGACCTGGAGAAG
ACGACGTGCCGGGAGATATACCGCTCGAGCGGCAGCAAAGACAGCGCCAAGAACTACGTGCCGTGGGACGTCGAC
GAGGATCGTCCGGAGGGAATGTTGGCCAGATTCGCGACTGATCTGGAGAGCAACGACGGGGGTGTTCACGCCATG
GTGGTCGGGACGGGAGCGAGCGAGGACTCTCGCGACGTACGGCACGCCTACATCGCCACGGGGGGGTCCGATAGG
AAGCTCCGATTCTGGGACGTGACACGTATCGAGAACTCGTGCGTTTATAGCGGGCTGCAGCCGGAGGAGGCGGTG
CCGACATACGGCGCCACGAACCCGACGACAGGCCTGACGCTCAACGCGGAGAGGACGTCGAGCGCGTCAACGAGG
AGCAAGGGCTCGGCGGGCTCCAGGCCGCCGCGGTCGACGGTGATTTCCATGCAGCAACAGCAGTTGCTGCAGTCG
CATATGGATGCGGTGCTGGACCTGGCTGTACTCGAGTATCCGTATACCATGAGCGTTCGTGACTGA
Transcript >Ophun1|2454
ATGGGCCAGGGCTTCTCTCTCGCGACGCCGTCCGCCGGCTCGGCCAGCATCGACGTTGCGCAGCTTCAGGACGTG
CAGTACGAGAGGAGCATCGGTAATGGCCGCTTCATGAAGAGTATCCGAGGCCGCCACGAGAACGGCGTCGTGCTC
GTCAAGGTGCTGGTCAAGCCCTTTGCCGAGGTCAAGCTCGACGAGTACAAGCGGCAGATCATAAGTCAGACGTCT
CCCGGCCGCAAGGCCCTGGCCAATGTCCCCAACGCTCTCGCTTTCCAGCGTATCATCGAGACGGAGACCAACGGC
TACCTCGTGAGGCAGTATCAGTACAGCTCTCTCTACGATCGCCTCAGCACTCGCCCTTTTCTCGAGGAGATTGAG
AAGAAATGGCTCGCTTTTCAGCTTCTGTGTGCTCTGCGAGACTGTCATGCCCGCGATGTCTACCACGGCGACATC
AAGGCGCAGAATGTCCTCGTCACGTCTTGGAACTGGCTGTATCTGACAGACTTTTCCTCGGCCTTTAAACCCATC
CTGCTTCCCGACGACAATCCTGCCGATTTCTCCTACTTCTTCGACACGTCGGGCCGGCGTACGTGCTATATTGCG
CCTGAGCGCTTCTATGTCGTTGGCGAGAACCCTCCGCCCAAGGCTGAGATGACGTGGGCCATGGACGTCTTCAGC
GCCGGCTGTGTCATTGCTCAGATGTTCTTGGAGTCGGAGCTCTTCAGTCTCGCTCAGCTATTCAAATATCGCCGT
GGCGAGCACGATCCCGTCGCGACACAACTAAGCGTCATTTCAGACCGGGAGGTCCGCGAAATGATCGCTCACATG
ATTCAGGTCGATCCCGAGAAGCGCTACTCGGCCGACCAATATCTGCAGTTCTGGAAAGTCAAAGTGTTCCCGCCT
TACTTCTACAGCTTTCTTCATCAGTACATGGAGCACATCACCGACCCATCCTCGGGTATCAGTCCCATGTCTGGC
TCACAGAAGAACATGGGGGAGTCCGACGACCGCATAGATCGCGTCTTCGGCGACTTTGACAAGATTTCCTATTTT
CTCGGCTATCAACCCGAGAAGCGGACGGCGACGGCAGTGCTACCGCCTGCGCGTTTAGGCCTTGGACACTTTCCC
GTCCGACTGAGCCTCGCCAACCATAACTTGCCTGTTTCGGCAGATCTCGAACCGCCGGAAGACGACGGCACCCTC
ATTTTTCTCAGCCTCATTGTCTCCTCACTGAGGACCACTGCTCGTGCCTCTTCGAGGGTTCGAGCGTGCGACATC
CTGCTTGCGTTTGCCGAGAGGCTCACGGATGAGGCCAAGCTAGATCGAGTATTGCCGTATCTGGTGACGCTCCTG
CGCTGGGACGAGGCCGACATCGTCGTCGTATCCGCTATCCGGACCATCACCCAGCTTCTACAGCTCGTCCGCATG
CCGACACCGATCAACTCTCACGTCCTAGTGGAATACGTGCTGCCGCGGATGGAAATGGCCCTCGGATCGAGGTTC
CGGGCTTCGAGTCCGCTGGTGAGGGCGACCTACGCCTCGTGTATTGGAAGCTTGGCCTCGACCGGGCAGCGCTTT
CTCGAGATAGCCTCGAGTCTCAGGGCGGACGGCTCCATGCCAATTGCAGACCCGGAAGTCGAGCCCGGCCTCGAC
GCCGAGGCCAACCTTGAGAGCGTCTTCGACACGGCTGGCAGGGAGCTATTCGAGATATTGGAGAGCCACACCAAG
CAGCTTGTTGAGGATCCGGACGTCTACGTGCGCCGGGCTTTCCTGACTTCGGTCCCGGAGCTGTGCATGTTCTTC
CAAGAGCACTCTAACGAGATCCTACTGACGCACCTCAACACGTACTTCAACGACCGCGACTGGACGCTCAAGTGT
GCTTTCTTCGACGCCGTGGTGGGCATCACAACTTTTATCGGGAGCACCAGCCTCGAGGAGTTTATGCTCCCCCTC
ATTGTTCAGGCTCTAGCGGACCCGGAGGAGTTTGTGGTGCAGGCCGCGATGCATTCGCTCGCGCAGCTCGCCGGT
CTGGGCCTCCTGTCGAGACCGAAGCTGTGGGAGCTGGCTGATGTCGCTGGAAGACTGACGATGCATCCGAATATG
TGGATACGGGAGGCGGCTGCCGAGTTTCTGGCAATGTCGGCCAGGTTCTTGGACACGGCCGATGTGAGATGCATA
CTGATGCCGCTGTTGAAGCCGTACCTAAAGGTCCCTTGCCTCGTGGACGTCTCGGAGCTCGGCATCTTGGACTGT
CTGAAGAAGCCGCTCACGCGAGCGGTGTTTGACCAAGCCATCGCCTGGGCATCGCAGGCCGATCGCGGCGTCTTC
TGGAAGTCCCTGAAGAGGGTACGATCTCTGTCCTTCGGGCAGTCGGGCGGACTTTCGGCGCCTTCGCAAGACCCG
AGCATTAGTTCGCTGGCCAAGGCTGCTCGCAATGAGGAGGACAGGCAGTGGCTTGAGAAGCTGAGAAAACTTGGG
CTCAAGCCAGAGGATGAACCCAAGCTCATCGCTCTCCGAGAGTATATATGGCGAACGTGCAAGGCCAAGCCACCA
CCGGTGCCACCGCCGACGACGACGACCAGTGAAGCGGTTTTGCCGACGGGGCTCGTCTCACTCAAGGCCCTAGGT
GTGACGCCGCAGACGGTTTTCTTCGACGACGCGCCTCTGACGGATTCCTCGGCCGCTGCCCCGGACCTCGGCTCA
CCTCCCGGGCCGTATACCATTGCCGAGGCGCTGCTAGACGCTTCTATGACTCTCGGAGACTCGGCTGCCAGGAAG
AGGCAGACGGCGTTCAACAGCCACGGGAACAGGGTGCACAGCGTCGGTCCTCGTCTTTCAAGAGCGACGAGGCGC
GCCTTGTCTCCAGGGGGAAGCGAGCGGGGAAGTTCGGTGCGGCCGAGAGGAGAGTCACCGATGAGCCGAGTAGGC
GGACCAGGAGATGAGGAGCTACTGATCCGGGACGGCCTCTACTCGGTCAGGAGAAACGTGCGGCATCAAGCCAGT
GCGCTGAGTCTCCTCGACCGCAAGGACGGCAATAAGTCGATCGCGGAGACGGCCACCAGTGACGCCAATGCGTTC
GGAGAGGTCGAGGGGCCCTTTATCCAGCCGTCGCCAGAGTCGGCGCGAGACATCGATGAGCGTCGGGCAGCCTCG
AGGCAGTCGAGACACAGCTACGAGGGGACCGACCCCAATATCCAGAGGATGCTCGACAGGATGTATATTGAAAAC
TTTCCCCGCGACGTGCTGGAGTTTGGCCCAATGGTGACGCCCATCGCCGGTGGCAAGCTCCGGATGCTCAACCCC
GAGCCCGGCTCCGGCGGCCAGTGGCGACCGGAAGGACACCTCGTGGCGACGTTTGCGGAGCACAAGGGCCCCGTC
AACAGGGTCGTCGCCTCTCCGGATCACGTCTTCTTCATCACGGGCGGCAGCGACGGCAGCGTGCGAGTCTGGGAC
ACGGCTAGACTGGAGCGAAACATCACTCACCGGTCGAGACAGACGCACCGTCACGCCGATGGCGCGCGTGTGACG
GCGCTTTGCTTCGTCGAGAAGACGCACTGCTTCGTGAGCTGCGCGAGCGACGGCAGCGTCCAGGTTGTCAAGGTC
GATACCGTCTCGGCCAGTGGCGTCCTTCGCTACGGAAAGCTGCGTGTTGTGCGCGATCATCGGCTGCCCGAGGGC
GAGGTGGCCGTCTGGTGCGAGCACTTCCGGCAGGAGTCGGCATCGGTTCTCATTCTGGCGACAAGCCGATCACGG
GTGCTGGGTATGGACCTGCGGACCATGACGGTACTGTACGAGCTGGAGAACCCGGTCCATCACGGGACGCCGACG
TGTTCTTGCGTCGACAAGAAGCGTAACTGGTTATGTCTGGGCACTTCTCATGGCGTCATCGACCTCTGGGACCTG
CGCTTCAAGATGAGGCTCAAGGCGTGGGGCATCCCTGGCAAGGCGGCCATTCACCGGATGAGCATCCATCCGGCC
AAGGGCCGCGGCAAGTGGGTGTGCGTTACGGGTGGGACGTGCCACGGCGAGGTGACGGTCTGGGACCTGGAGAAG
ACGACGTGCCGGGAGATATACCGCTCGAGCGGCAGCAAAGACAGCGCCAAGAACTACGTGCCGTGGGACGTCGAC
GAGGATCGTCCGGAGGGAATGTTGGCCAGATTCGCGACTGATCTGGAGAGCAACGACGGGGGTGTTCACGCCATG
GTGGTCGGGACGGGAGCGAGCGAGGACTCTCGCGACGTACGGCACGCCTACATCGCCACGGGGGGGTCCGATAGG
AAGCTCCGATTCTGGGACGTGACACGTATCGAGAACTCGTGCGTTTATAGCGGGCTGCAGCCGGAGGAGGCGGTG
CCGACATACGGCGCCACGAACCCGACGACAGGCCTGACGCTCAACGCGGAGAGGACGTCGAGCGCGTCAACGAGG
AGCAAGGGCTCGGCGGGCTCCAGGCCGCCGCGGTCGACGGTGATTTCCATGCAGCAACAGCAGTTGCTGCAGTCG
CATATGGATGCGGTGCTGGACCTGGCTGTACTCGAGTATCCGTATACCATGAGCGTTCGTGACTGA
Gene >Ophun1|2454
ATGGGCCAGGGCTTCTCTCTCGCGACGCCGTCCGCCGGCTCGGCCAGCATCGACGTTGCGCAGCTTCAGGACGTG
CAGTACGAGAGGAGCATCGGTAATGGCCGCTTCATGAAGAGTATCCGAGGCCGCCACGAGAACGGCGTCGTGCTC
GTCAAGGTGCTGGTCAAGCCCTTTGCCGAGGTCAAGCTCGACGAGTACAAGCGGCAGATCATAAGTCAGACGTCT
CCCGGCGTACGTCTCTGTGATCGCGCACTCACCAGCTACAGAACAGCGCAAGGCCCTGGCCAATGTCCCCAACGC
TCTCGCTTTCCAGCGTATCATCGAGACGGAGACCAACGGCTACCTCGTGAGGCAGTATCAGTACAGCTCTCTCTA
CGATCGCCTCAGCACTCGCCCTTTTCTCGAGGAGATTGAGAAGAAATGGCTCGCTTTTCAGCTTCTGTGTGCTCT
GCGAGACTGTCATGCCCGCGATGTCTACCACGGCGACATCAAGGCGCAGAATGTCCTCGTCACGTCTTGGAACTG
GCTGTATCTGACAGACTTTTCCTCGGCCTTTAAACCCATCCTGCTTCCCGACGACAATCCTGCCGATTTCTCCTA
CTTCTTCGACACGTCGGGCCGGCGTACGTGCTATATTGCGCCTGAGCGCTTCTATGTCGTTGGCGAGAACCCTCC
GCCCAAGGCTGAGATGACGTGGGCCATGGACGTCTTCAGCGCCGGCTGTGTCATTGCTCAGATGTTCTTGGAGTC
GGAGCTCTTCAGTCTCGCTCAGCTATTCAAATATCGCCGTGGCGAGCACGATCCCGTCGCGACACAACTAAGCGT
CATTTCAGACCGGGAGGTCCGCGAAATGATCGCTCACATGATTCAGGTCGATCCCGAGAAGCGCTACTCGGCCGA
CCAATATCTGCAGTTCTGGAAAGTCAAAGTGTTCCCGCCTTACTTCTACAGCTTTCTTCATCAGTACATGGAGCA
CATCACCGACCCATCCTCGGGTATCAGTCCCATGTCTGGCTCACAGAAGAACATGGGGGAGTCCGACGACCGCAT
AGATCGCGTCTTCGGCGACTTTGACAAGATTTCCTATTTTCTCGGCTATCAACCCGAGAAGCGGACGGCGACGGC
AGTGCTACCGCCTGCGCGTTTAGGCCTTGGACACTTTCCCGTCCGACTGAGCCTCGCCAACCATAACTTGCCTGT
TTCGGCAGATCTCGAACCGCCGGAAGACGACGGCACCCTCATTTTTCTCAGCCTCATTGTCTCCTCACTGAGGAC
CACTGCTCGTGCCTCTTCGAGGGTTCGAGCGTGCGACATCCTGCTTGCGTTTGCCGAGAGGCTCACGGATGAGGC
CAAGCTAGATCGAGTATTGCCGTATCTGGTGACGCTCCTGCGCTGGGACGAGGCCGACATCGTCGTCGTATCCGC
TATCCGGACCATCACCCAGCTTCTACAGCTCGTCCGCATGCCGACACCGATCAACTCTCACGTCCTAGTGGAATA
CGTGCTGCCGCGGATGGAAATGGCCCTCGGATCGAGGTTCCGGGCTTCGAGTCCGCTGGTGAGGGCGACCTACGC
CTCGTGTATTGGAAGCTTGGCCTCGACCGGGCAGCGCTTTCTCGAGATAGCCTCGAGTCTCAGGGCGGACGGCTC
CATGCCAATTGCAGACCCGGAAGTCGAGCCCGGCCTCGACGCCGAGGCCAACCTTGAGAGCGTCTTCGACACGGC
TGGCAGGGAGCTATTCGAGATATTGGAGAGCCACACCAAGCAGCTTGTTGAGGATCCGGACGTCTACGTGCGCCG
GGCTTTCCTGACTTCGGTCCCGGAGCTGTGCATGTTCTTCCAAGAGCACTCTAACGAGATCCTACTGACGCACCT
CAACACGTACTTCAACGACCGCGACTGGACGCTCAAGTGTGCTTTCTTCGACGCCGTGGTGGGCATCACAACTTT
TATCGGGAGCACCAGCCTCGAGGAGTTTATGCTCCCCCTCATTGTTCAGGCTCTAGCGGACCCGGAGGAGTTTGT
GGTGCAGGCCGCGATGCATTCGCTCGCGCAGCTCGCCGGTCTGGGCCTCCTGTCGAGACCGAAGCTGTGGGAGCT
GGCTGATGTCGCTGGAAGACTGACGATGCATCCGAATATGTGGATACGGGAGGCGGCTGCCGAGTTTCTGGCAAT
GTCGGCCAGGTTCTTGGACACGGCCGATGTGAGATGCATACTGATGCCGCTGTTGAAGCCGTACCTAAAGGTCCC
TTGCCTCGTGGACGTCTCGGAGCTCGGCATCTTGGACTGTCTGAAGAAGCCGCTCACGCGAGCGGTGTTTGACCA
AGCCATCGCCTGGGCATCGCAGGCCGATCGCGGCGTCTTCTGGAAGTCCCTGAAGAGGGTACGATCTCTGTCCTT
CGGGCAGTCGGGCGGACTTTCGGCGCCTTCGCAAGACCCGAGCATTAGTTCGCTGGCCAAGGCTGCTCGCAATGA
GGAGGACAGGCAGTGGCTTGAGAAGCTGAGAAAACTTGGGCTCAAGCCAGAGGATGAACCCAAGCTCATCGCTCT
CCGAGAGTATATATGGCGAACGTGCAAGGCCAAGCCACCACCGGTGCCACCGCCGACGACGACGACCAGTGAAGC
GGTTTTGCCGACGGGGCTCGTCTCACTCAAGGCCCTAGGTGTGACGCCGCAGACGGTTTTCTTCGACGACGCGCC
TCTGACGGATTCCTCGGCCGCTGCCCCGGACCTCGGCTCACCTCCCGGGCCGTATACCATTGCCGAGGCGCTGCT
AGACGCTTCTATGACTCTCGGAGACTCGGCTGCCAGGAAGAGGCAGACGGCGTTCAACAGCCACGGGAACAGGGT
GCACAGCGTCGGTCCTCGTCTTTCAAGAGCGACGAGGCGCGCCTTGTCTCCAGGGGGAAGCGAGCGGGGAAGTTC
GGTGCGGCCGAGAGGAGAGTCACCGATGAGCCGAGTAGGCGGACCAGGAGATGAGGAGCTACTGATCCGGGACGG
CCTCTACTCGGTCAGGAGAAACGTGCGGCATCAAGCCAGTGCGCTGAGTCTCCTCGACCGCAAGGACGGCAATAA
GTCGATCGCGGAGACGGCCACCAGTGACGCCAATGCGTTCGGAGAGGTCGAGGGGCCCTTTATCCAGCCGTCGCC
AGAGTCGGCGCGAGACATCGATGAGCGTCGGGCAGCCTCGAGGCAGTCGAGACACAGCTACGAGGGGACCGACCC
CAATATCCAGAGGATGCTCGACAGGATGTATATTGAAAACTTTCCCCGCGACGTGCTGGAGTTTGGCCCAATGGT
GACGCCCATCGCCGGTGGCAAGCTCCGGATGCTCAACCCCGAGCCCGGCTCCGGCGGCCAGTGGCGACCGGAAGG
ACACCTCGTGGCGACGTTTGCGGAGCACAAGGGCCCCGTCAACAGGGTCGTCGCCTCTCCGGATCACGTCTTCTT
CATCACGGGCGGCAGCGACGGCAGCGTGCGAGTCTGGGACACGGCTAGACTGGAGCGAAACATCACTCACCGGTC
GAGACAGACGCACCGTCACGCCGATGGCGCGCGTGTGACGGCGCTTTGCTTCGTCGAGAAGACGCACTGCTTCGT
GAGCTGCGCGAGCGACGGCAGCGTCCAGGTTGTCAAGGTCGATACCGTCTCGGCCAGTGGCGTCCTTCGCTACGG
AAAGCTGCGTGTTGTGCGCGATCATCGGCTGCCCGAGGGCGAGGTGGCCGTCTGGTGCGAGCACTTCCGGCAGGA
GTCGGCATCGGTTCTCATTCTGGCGACAAGCCGATCACGGGTGCTGGGTATGGACCTGCGGACCATGACGGTACT
GTACGAGCTGGAGAACCCGGTCCATCACGGGACGCCGACGTGTTCTTGCGTCGACAAGAAGCGTAACTGGTTATG
TCTGGGCACTTCTCATGGCGTCATCGACCTCTGGGACCTGCGCTTCAAGATGAGGCTCAAGGCGTGGGGCATCCC
TGGCAAGGCGGCCATTCACCGGATGAGCATCCATCCGGCCAAGGGCCGCGGCAAGTGGGTGTGCGTTACGGGTGG
GACGTGCCACGGCGAGGTGACGGTCTGGGACCTGGAGAAGACGACGTGCCGGGAGATATACCGCTCGAGCGGCAG
CAAAGACAGCGCCAAGAACTACGTGCCGTGGGACGTCGACGAGGATCGTCCGGAGGGAATGTTGGCCAGATTCGC
GACTGATCTGGAGAGCAACGACGGGGGTGTTCACGCCATGGTGGTCGGGACGGGAGCGAGCGAGGACTCTCGCGA
CGTACGGCACGCCTACATCGCCACGGGGGGGTCCGATAGGAAGCTCCGATTCTGGGACGTGACACGTATCGAGAA
CTCGTGCGTTTATAGCGGGCTGCAGCCGGAGGAGGCGGTGCCGACATACGGCGCCACGAACCCGACGACAGGCCT
GACGCTCAACGCGGAGAGGACGTCGAGCGCGTCAACGAGGAGCAAGGGCTCGGCGGGCTCCAGGCCGCCGCGGTC
GACGGTGATTTCCATGCAGCAACAGCAGTTGCTGCAGTCGCATATGGATGCGGTGCTGGACCTGGCTGTACTCGA
GTATCCGTATACCATGAGCGTGTCGGTCGACAGGTCGGGGGCTGTTTTTGTTTTTCAGTAGGCGCATAGGTGGAG
GGGATACAAGGTGAATATAGAGGTTTTGAACGCTCCTCAGGCTTGAATGATGGGTTCTGGCGTTGGTGCTGAGGA
GAGGAGACGGCTAATGATGGAAGGGAGTTGGATGGAGGCTGGACAGTTCGCACGAGGCTGGCGAATGATAGATCG
AGGCTACGCTAAGCTTTCGGGACGAGGCTTGTAGTGGGCTTGTGGCTAGTGACAGATGGTGTGGCGTGAGATGTT
GCTTGAGCTCCGTCTTGTCTAAGTGAGTGAGTCGGCCACGCTCCAAGTAAAGTCATGACTGACTGACTGACTGAC
TTTTGAAAGTCGTGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail