Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2452
Gene name
LocationContig_221:12782..13568
Strand+
Gene length (bp)786
Transcript length (bp)786
Coding sequence length (bp)786
Protein length (aa) 262

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12766 Pyridox_oxase_2 Pyridoxamine 5'-phosphate oxidase 4.0E-20 15 134

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0010181 FMN binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2452
MPPPSTRAASALTEAPWRAAFLSHIQQLEPPIFYLSTLRAGRGQSPSPACRTVIYRGMWAGLAAHPKNPARLNPD
VYQTHLPTLTTDARMDKTSELMATEAEAAQSGGGGPVEAVFWAPKVQTQWRLRGRGYVVGPDIDTEAGALVRAAL
NPYMHRVGDGSEDAWSWSRELTAHFGNLSPLMRGSFRNPPPGTPLDQTPEPLGQGQTIDGVDDGVARANFRVVVI
VPDEVDRVDLSDPKRGRRWNYRVGDDGSWKVTELWP*
Coding >Ophun1|2452
ATGCCCCCCCCATCAACAAGAGCCGCCTCGGCACTGACCGAGGCCCCTTGGCGTGCGGCCTTTCTGTCCCATATC
CAGCAGCTCGAGCCACCAATCTTCTATCTCAGCACCCTCCGAGCCGGCCGGGGCCAGTCTCCGTCGCCGGCCTGC
CGCACCGTCATCTACCGCGGGATGTGGGCCGGCTTGGCGGCTCACCCCAAGAACCCGGCCCGTCTCAACCCTGAC
GTGTACCAGACCCATCTGCCGACCCTCACCACGGATGCCCGCATGGACAAGACGTCGGAGCTTATGGCCACCGAA
GCCGAAGCCGCTCAGTCCGGCGGCGGCGGCCCCGTTGAGGCCGTCTTCTGGGCACCCAAGGTCCAGACCCAGTGG
CGTCTTCGCGGCCGCGGCTACGTCGTCGGTCCAGACATTGATACCGAGGCCGGCGCGTTGGTGAGGGCCGCCCTG
AACCCCTACATGCACCGCGTCGGAGACGGCTCCGAAGACGCCTGGAGCTGGAGCCGCGAGCTCACGGCGCACTTT
GGGAACCTGAGCCCCCTGATGAGGGGTTCGTTCCGCAACCCGCCTCCAGGGACGCCGCTGGACCAGACGCCCGAG
CCCCTTGGCCAGGGCCAGACGATCGACGGCGTCGATGATGGCGTGGCTCGGGCCAACTTCCGCGTCGTTGTCATC
GTGCCGGACGAGGTCGACAGGGTTGACCTTTCGGATCCGAAACGAGGCCGCAGATGGAACTACAGGGTCGGCGAC
GACGGCTCTTGGAAGGTGACGGAGCTGTGGCCGTAA
Transcript >Ophun1|2452
ATGCCCCCCCCATCAACAAGAGCCGCCTCGGCACTGACCGAGGCCCCTTGGCGTGCGGCCTTTCTGTCCCATATC
CAGCAGCTCGAGCCACCAATCTTCTATCTCAGCACCCTCCGAGCCGGCCGGGGCCAGTCTCCGTCGCCGGCCTGC
CGCACCGTCATCTACCGCGGGATGTGGGCCGGCTTGGCGGCTCACCCCAAGAACCCGGCCCGTCTCAACCCTGAC
GTGTACCAGACCCATCTGCCGACCCTCACCACGGATGCCCGCATGGACAAGACGTCGGAGCTTATGGCCACCGAA
GCCGAAGCCGCTCAGTCCGGCGGCGGCGGCCCCGTTGAGGCCGTCTTCTGGGCACCCAAGGTCCAGACCCAGTGG
CGTCTTCGCGGCCGCGGCTACGTCGTCGGTCCAGACATTGATACCGAGGCCGGCGCGTTGGTGAGGGCCGCCCTG
AACCCCTACATGCACCGCGTCGGAGACGGCTCCGAAGACGCCTGGAGCTGGAGCCGCGAGCTCACGGCGCACTTT
GGGAACCTGAGCCCCCTGATGAGGGGTTCGTTCCGCAACCCGCCTCCAGGGACGCCGCTGGACCAGACGCCCGAG
CCCCTTGGCCAGGGCCAGACGATCGACGGCGTCGATGATGGCGTGGCTCGGGCCAACTTCCGCGTCGTTGTCATC
GTGCCGGACGAGGTCGACAGGGTTGACCTTTCGGATCCGAAACGAGGCCGCAGATGGAACTACAGGGTCGGCGAC
GACGGCTCTTGGAAGGTGACGGAGCTGTGGCCGTAA
Gene >Ophun1|2452
ATGCCCCCCCCATCAACAAGAGCCGCCTCGGCACTGACCGAGGCCCCTTGGCGTGCGGCCTTTCTGTCCCATATC
CAGCAGCTCGAGCCACCAATCTTCTATCTCAGCACCCTCCGAGCCGGCCGGGGCCAGTCTCCGTCGCCGGCCTGC
CGCACCGTCATCTACCGCGGGATGTGGGCCGGCTTGGCGGCTCACCCCAAGAACCCGGCCCGTCTCAACCCTGAC
GTGTACCAGACCCATCTGCCGACCCTCACCACGGATGCCCGCATGGACAAGACGTCGGAGCTTATGGCCACCGAA
GCCGAAGCCGCTCAGTCCGGCGGCGGCGGCCCCGTTGAGGCCGTCTTCTGGGCACCCAAGGTCCAGACCCAGTGG
CGTCTTCGCGGCCGCGGCTACGTCGTCGGTCCAGACATTGATACCGAGGCCGGCGCGTTGGTGAGGGCCGCCCTG
AACCCCTACATGCACCGCGTCGGAGACGGCTCCGAAGACGCCTGGAGCTGGAGCCGCGAGCTCACGGCGCACTTT
GGGAACCTGAGCCCCCTGATGAGGGGTTCGTTCCGCAACCCGCCTCCAGGGACGCCGCTGGACCAGACGCCCGAG
CCCCTTGGCCAGGGCCAGACGATCGACGGCGTCGATGATGGCGTGGCTCGGGCCAACTTCCGCGTCGTTGTCATC
GTGCCGGACGAGGTCGACAGGGTTGACCTTTCGGATCCGAAACGAGGCCGCAGATGGAACTACAGGGTCGGCGAC
GACGGCTCTTGGAAGGTGACGGAGCTGTGGCCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail