Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2440
Gene name
LocationContig_220:14794..15958
Strand+
Gene length (bp)1164
Transcript length (bp)1005
Coding sequence length (bp)1005
Protein length (aa) 335

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1JQ66|S35E3_DANRE Solute carrier family 35 member E3 OS=Danio rerio GN=slc35e3 PE=2 SV=1 35 333 7.0E-41
sp|Q7Z769|S35E3_HUMAN Solute carrier family 35 member E3 OS=Homo sapiens GN=SLC35E3 PE=2 SV=1 41 333 2.0E-36
sp|Q6PGC7|S35E3_MOUSE Solute carrier family 35 member E3 OS=Mus musculus GN=Slc35e3 PE=2 SV=1 41 333 3.0E-35
sp|A4IFK2|S35E3_BOVIN Solute carrier family 35 member E3 OS=Bos taurus GN=SLC35E3 PE=2 SV=1 36 333 5.0E-35
sp|Q9SRE4|UGAL2_ARATH UDP-galactose transporter 2 OS=Arabidopsis thaliana GN=UDP-GALT2 PE=2 SV=1 22 333 2.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1JQ66|S35E3_DANRE Solute carrier family 35 member E3 OS=Danio rerio GN=slc35e3 PE=2 SV=1 35 333 7.0E-41
sp|Q7Z769|S35E3_HUMAN Solute carrier family 35 member E3 OS=Homo sapiens GN=SLC35E3 PE=2 SV=1 41 333 2.0E-36
sp|Q6PGC7|S35E3_MOUSE Solute carrier family 35 member E3 OS=Mus musculus GN=Slc35e3 PE=2 SV=1 41 333 3.0E-35
sp|A4IFK2|S35E3_BOVIN Solute carrier family 35 member E3 OS=Bos taurus GN=SLC35E3 PE=2 SV=1 36 333 5.0E-35
sp|Q9SRE4|UGAL2_ARATH UDP-galactose transporter 2 OS=Arabidopsis thaliana GN=UDP-GALT2 PE=2 SV=1 22 333 2.0E-25
sp|Q8RXL8|Y1689_ARATH Uncharacterized membrane protein At1g06890 OS=Arabidopsis thaliana GN=At1g06890 PE=1 SV=1 52 324 1.0E-22
sp|Q9SFE9|GONS5_ARATH GDP-mannose transporter GONST5 OS=Arabidopsis thaliana GN=GONST5 PE=2 SV=1 35 326 3.0E-12
sp|Q9C521|UGAL1_ARATH UDP-galactose transporter 1 OS=Arabidopsis thaliana GN=UDP-GALT1 PE=2 SV=1 35 326 8.0E-11
sp|Q550W6|FUCT1_DICDI GDP-fucose transporter 1 OS=Dictyostelium discoideum GN=slc35c1 PE=3 SV=1 2 332 2.0E-10
sp|A9UUB8|FUCT1_MONBE GDP-fucose transporter 1 OS=Monosiga brevicollis GN=slc35c1 PE=3 SV=1 11 291 2.0E-07
sp|Q6DBP3|PT505_ARATH Probable sugar phosphate/phosphate translocator At5g05820 OS=Arabidopsis thaliana GN=At5g05820 PE=2 SV=1 44 332 1.0E-06
sp|Q9UUI8|YIY4_SCHPO Uncharacterized transporter C22F8.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22F8.04 PE=3 SV=1 110 332 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.5

Transmembrane Domains

Domain # Start End Length
1 35 57 22
2 70 92 22
3 102 124 22
4 137 171 34
5 186 208 22
6 220 239 19
7 254 276 22
8 283 300 17
9 310 328 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2440
MDEEKDTLRPLSPSVDEELALRPRDEASPPLAVSVAWMAVNTLATVGIVFTNKAIFSDASWRLSQLTFACFHFFV
TWITLLVLASPALAFFVPRRVPIRHLLPLALAMCLNVILPNYSLAFSSVTFYQVARVLLTPVVALLNFVLYGATL
PPLAGLALVPACMGVGIVSYYDSLPAADTSIKTTSPLGVAFAMAGVLASSLYTVLIASYHKKLQMSSMQLLYSQA
PMASFMLLYMIPFLDTLPDPSHVSASRWLMVMLSGAFASLINISQFFIVAHTGPVSSTVVGHVKTCTIVCIGWIV
SGRSADDRALVGVFLAMAAILVYSIVMLEARKSV*
Coding >Ophun1|2440
ATGGACGAGGAAAAGGACACGCTTCGCCCGTTGTCGCCCTCCGTGGACGAGGAGCTGGCCTTGCGTCCTCGCGAT
GAAGCTTCGCCGCCGCTCGCCGTATCCGTCGCTTGGATGGCCGTCAACACCTTGGCCACGGTCGGAATCGTCTTT
ACCAACAAAGCAATCTTCTCGGATGCCTCGTGGCGCTTGTCTCAGCTCACCTTTGCCTGTTTCCACTTCTTCGTC
ACCTGGATCACGCTCTTGGTGCTGGCGAGCCCGGCTCTGGCCTTTTTCGTTCCCCGGCGCGTTCCCATCCGTCAT
CTGCTTCCTCTCGCCCTCGCCATGTGTCTCAATGTCATTCTTCCCAACTACTCATTGGCCTTTTCCTCCGTCACC
TTTTACCAGGTCGCTCGCGTCTTGCTGACGCCCGTCGTGGCCCTTCTCAACTTTGTTCTATATGGGGCTACGCTG
CCACCGCTCGCCGGTCTGGCCCTTGTACCGGCCTGCATGGGCGTCGGCATCGTATCTTACTACGACTCTCTCCCG
GCTGCCGATACTAGCATCAAGACGACATCGCCCCTGGGCGTTGCCTTTGCTATGGCCGGTGTCTTGGCTTCTTCA
CTCTATACCGTTTTGATCGCCAGCTACCACAAGAAACTACAGATGAGCAGCATGCAGCTTCTCTACAGCCAAGCA
CCCATGGCCTCATTTATGCTTCTCTACATGATCCCCTTTCTCGATACGCTTCCTGATCCGAGCCACGTCTCCGCG
TCTAGGTGGTTGATGGTTATGCTGTCCGGAGCATTTGCCTCTCTCATCAACATATCACAATTCTTCATCGTCGCA
CACACCGGCCCTGTCTCGAGCACCGTTGTTGGCCACGTCAAGACGTGCACCATTGTGTGCATCGGATGGATCGTG
TCTGGCCGATCTGCCGACGACAGGGCTCTGGTCGGCGTGTTTCTTGCCATGGCTGCAATACTAGTGTACTCTATC
GTCATGTTGGAAGCGCGCAAGTCGGTGTAG
Transcript >Ophun1|2440
ATGGACGAGGAAAAGGACACGCTTCGCCCGTTGTCGCCCTCCGTGGACGAGGAGCTGGCCTTGCGTCCTCGCGAT
GAAGCTTCGCCGCCGCTCGCCGTATCCGTCGCTTGGATGGCCGTCAACACCTTGGCCACGGTCGGAATCGTCTTT
ACCAACAAAGCAATCTTCTCGGATGCCTCGTGGCGCTTGTCTCAGCTCACCTTTGCCTGTTTCCACTTCTTCGTC
ACCTGGATCACGCTCTTGGTGCTGGCGAGCCCGGCTCTGGCCTTTTTCGTTCCCCGGCGCGTTCCCATCCGTCAT
CTGCTTCCTCTCGCCCTCGCCATGTGTCTCAATGTCATTCTTCCCAACTACTCATTGGCCTTTTCCTCCGTCACC
TTTTACCAGGTCGCTCGCGTCTTGCTGACGCCCGTCGTGGCCCTTCTCAACTTTGTTCTATATGGGGCTACGCTG
CCACCGCTCGCCGGTCTGGCCCTTGTACCGGCCTGCATGGGCGTCGGCATCGTATCTTACTACGACTCTCTCCCG
GCTGCCGATACTAGCATCAAGACGACATCGCCCCTGGGCGTTGCCTTTGCTATGGCCGGTGTCTTGGCTTCTTCA
CTCTATACCGTTTTGATCGCCAGCTACCACAAGAAACTACAGATGAGCAGCATGCAGCTTCTCTACAGCCAAGCA
CCCATGGCCTCATTTATGCTTCTCTACATGATCCCCTTTCTCGATACGCTTCCTGATCCGAGCCACGTCTCCGCG
TCTAGGTGGTTGATGGTTATGCTGTCCGGAGCATTTGCCTCTCTCATCAACATATCACAATTCTTCATCGTCGCA
CACACCGGCCCTGTCTCGAGCACCGTTGTTGGCCACGTCAAGACGTGCACCATTGTGTGCATCGGATGGATCGTG
TCTGGCCGATCTGCCGACGACAGGGCTCTGGTCGGCGTGTTTCTTGCCATGGCTGCAATACTAGTGTACTCTATC
GTCATGTTGGAAGCGCGCAAGTCGGTGTAG
Gene >Ophun1|2440
ATGGACGAGGAAAAGGACACGCTTCGCCCGTTGTCGCCCTCCGTGGACGAGGAGCTGGCCTTGCGTCCTCGCGAT
GAAGCTTCGCCGCCGCTCGCCGTATCCGTCGCTTGGATGGCCGTCAACACCTTGGCCACGGTCGGAATCGTATGC
CCGAGACCCCCTCCGAGACGCTGATCCTGCCTCTCATCAAGACTCCTTTCAGGTCTTTACCAACAAAGCAATCTT
CTCGGATGCCTCGTGGCGCTTGTCTCAGCTCACCTTTGCCTGTTTCCACTTCTTCGTCACCTGGATCACGCTCTT
GGTGCTGGCGAGCCCGGCTCTGGCCTTTTTCGTTCCCCGGCGCGTTCCCATCCGTCATCTGCTTCCTCTCGCCCT
CGCCATGTGTCTCAATGTCATTCTTCCCAACTACTCATTGGCCTTTTCCTCCGTCACCTTTTACCAGGTCGCTCG
CGTCTTGCTGACGCCCGTCGTGGCCCTTCTCAACTTTGTTCTATATGGGGCTACGCTGCCACCGCTCGCCGGTCT
GGCCCTTGTACCGGCCTGCATGGGCGTCGGCATCGTATCTTACTACGACTCTCTCCCGGCTGCCGATACTAGCAT
CAAGACGACATCGCCCCTGGGCGTTGCCTTTGCTATGGCCGGTGTCTTGGCTTCTTCACTCTATACCGTTTTGAT
CGCCAGCTACCACAAGAAACTACAGATGAGCAGCATGCAGCTTCTCTACAGCCAAGCACCCATGGCCTCATTTAT
GCTTCTCTACATGATCCCCTTTCTCGATACGCTTCCTGATCCGAGCCACGTCTCCGCGTCTAGGTGGTTGATGGT
TATGCTGGTATGCGACTCCCTCTGGTCGTGTGCTGGCGTTAACAAACCAGTCCGGAGCATTTGCCTCTCTCATCA
ACATATCACAATTCTTCATCGTCGCACACACCGGCCCTGTCTCGAGCACCGTTGTTGGCCACGTCAAGACGTGCA
CCATTGTGTGCATCGGATGGATCGTGTCTGGCCGATCTGCCGACGACAGGGCTCTGGTCGGCGTGTTTCTTGCCA
TGGCTGCAATACTAGTGTGAGACGCTTCCGATGCTGGTCGACTGTATCGCGTGCGCCACTAATCTCCGATGCAGG
TACTCTATCGTCATGTTGGAAGCGCGCAAGTCGGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail