Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2435
Gene name
LocationContig_22:61677..63378
Strand+
Gene length (bp)1701
Transcript length (bp)1701
Coding sequence length (bp)1701
Protein length (aa) 567

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02190 LON_substr_bdg ATP-dependent protease La (LON) substrate-binding domain 1.8E-24 312 553
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 5.0E-11 222 259
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.5E-07 222 259
PF13445 zf-RING_UBOX RING-type zinc-finger 3.1E-07 222 257
PF13639 zf-RING_2 Ring finger domain 9.6E-08 221 260
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 9.9E-07 220 262

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60106|YOXA_SCHPO LON peptidase N-terminal domain and RING finger protein C14F5.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC14F5.10c PE=3 SV=1 49 405 8.0E-32
sp|Q8HXH0|LONF3_MACFA LON peptidase N-terminal domain and RING finger protein 3 OS=Macaca fascicularis GN=LONRF3 PE=2 SV=1 218 550 1.0E-31
sp|Q496Y0|LONF3_HUMAN LON peptidase N-terminal domain and RING finger protein 3 OS=Homo sapiens GN=LONRF3 PE=1 SV=1 218 427 2.0E-31
sp|Q9D4H7|LONF3_MOUSE LON peptidase N-terminal domain and RING finger protein 3 OS=Mus musculus GN=Lonrf3 PE=2 SV=1 218 427 3.0E-30
sp|Q1L5Z9|LONF2_HUMAN LON peptidase N-terminal domain and RING finger protein 2 OS=Homo sapiens GN=LONRF2 PE=2 SV=3 219 550 6.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60106|YOXA_SCHPO LON peptidase N-terminal domain and RING finger protein C14F5.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC14F5.10c PE=3 SV=1 49 405 8.0E-32
sp|Q8HXH0|LONF3_MACFA LON peptidase N-terminal domain and RING finger protein 3 OS=Macaca fascicularis GN=LONRF3 PE=2 SV=1 218 550 1.0E-31
sp|Q496Y0|LONF3_HUMAN LON peptidase N-terminal domain and RING finger protein 3 OS=Homo sapiens GN=LONRF3 PE=1 SV=1 218 427 2.0E-31
sp|Q9D4H7|LONF3_MOUSE LON peptidase N-terminal domain and RING finger protein 3 OS=Mus musculus GN=Lonrf3 PE=2 SV=1 218 427 3.0E-30
sp|Q1L5Z9|LONF2_HUMAN LON peptidase N-terminal domain and RING finger protein 2 OS=Homo sapiens GN=LONRF2 PE=2 SV=3 219 550 6.0E-30
sp|Q17RB8|LONF1_HUMAN LON peptidase N-terminal domain and RING finger protein 1 OS=Homo sapiens GN=LONRF1 PE=1 SV=2 183 565 1.0E-29
sp|Q61510|TRI25_MOUSE E3 ubiquitin/ISG15 ligase TRIM25 OS=Mus musculus GN=Trim25 PE=1 SV=2 216 291 1.0E-07
sp|Q9P3U8|YJ95_SCHPO Uncharacterized RING finger protein C548.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC548.05c PE=3 SV=1 207 267 3.0E-06
sp|Q2YEM9|TRIM5_PONPY Tripartite motif-containing protein 5 OS=Pongo pygmaeus GN=TRIM5 PE=2 SV=1 215 312 3.0E-06
sp|Q5C8T8|TRIM5_PONAB Tripartite motif-containing protein 5 OS=Pongo abelii GN=TRIM5 PE=2 SV=1 215 312 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 309 331 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2435
MSTDLPDADASLPPPEPPASGQNQPMLDASIFRENPLANSGPSNTQARDIVRLFQCHVCSAPYEHIISLPCGGSI
CRTCMPVPFIRTGVSFPASEHRREGFICPYEDCEKVHAVVDCGTDIILNKVAEIVQAEMKRGIDDAARLELSVRI
KLFNWSEDESPSPTDGLLMGGSRLMATWALAAQRKLPFDADVVVCDEGQQNDECDYSVIGALQKTLRAEMDCQIC
YSLLYDPLTAECGHTFCRSCLLRVFVVNRRCPMCRRDLCIDPQLQPYVCPPNDRILEITETFWEDELKARGQAMA
AEAGSSDDYVLIPLFICGLVFPTMPLILNVFEEHYRVMIRRVIEGDMTFGVVMPRSPDHQGDADFYQFGTLMQIV
DYQHLPDGRSLVESKGLSRFRVVTFSRVDGYSVGKALRIDDVGLQQEEALELAEVGYDVSDSAAGSRAADAEMTD
PTSTSETSFWSSLCQFGSELPQSTMDLHAMTTQSLARFVLGFVDRTKEKQLPWLTDRVLRTYGSCPTDPAAVPWW
LGSTMPVPIEQRYELLNTHTVRDRLKICGWWILNVRDWSKR*
Coding >Ophun1|2435
ATGTCCACAGATCTGCCAGATGCGGACGCCTCGCTTCCTCCGCCGGAACCCCCCGCCAGCGGACAGAACCAGCCG
ATGCTCGACGCCTCTATCTTCAGAGAGAATCCGCTGGCAAACTCGGGGCCTTCTAACACTCAGGCCCGCGACATA
GTCCGCCTATTCCAATGTCACGTCTGCTCGGCCCCCTACGAGCACATCATCAGCCTCCCCTGCGGCGGAAGCATC
TGCAGGACCTGCATGCCTGTGCCTTTCATCCGTACGGGTGTCAGCTTCCCGGCCTCGGAACATCGACGCGAGGGC
TTCATCTGCCCCTATGAAGACTGCGAAAAGGTGCACGCCGTCGTCGACTGCGGCACTGACATCATACTCAACAAG
GTGGCCGAAATCGTCCAAGCCGAGATGAAGCGCGGCATCGACGACGCAGCCAGACTCGAATTGTCGGTGCGCATC
AAGCTCTTCAATTGGAGTGAGGATGAGTCCCCTTCGCCCACAGACGGCCTTCTCATGGGCGGCTCTCGCCTGATG
GCCACCTGGGCTTTGGCAGCTCAGAGAAAGCTCCCCTTCGACGCCGACGTCGTCGTCTGTGACGAGGGCCAGCAG
AACGACGAGTGCGATTACAGCGTCATCGGAGCGCTGCAAAAGACGCTGCGTGCCGAGATGGACTGTCAGATCTGC
TACTCGCTCTTGTACGATCCCTTGACGGCCGAATGTGGCCACACCTTTTGTCGATCCTGTCTTCTCCGCGTCTTC
GTCGTCAACCGCCGCTGTCCCATGTGTCGGCGTGACCTCTGCATCGATCCTCAACTGCAACCCTACGTCTGTCCG
CCAAACGACCGCATCCTCGAAATCACCGAGACGTTCTGGGAAGATGAGTTGAAGGCTCGGGGACAGGCTATGGCT
GCCGAGGCCGGGTCGTCTGATGATTACGTCCTGATCCCGCTCTTCATCTGCGGCCTGGTCTTTCCCACCATGCCC
TTGATTCTGAACGTGTTCGAAGAGCACTACAGGGTCATGATTCGGCGTGTCATCGAGGGCGACATGACGTTTGGC
GTCGTCATGCCGCGCTCGCCGGATCATCAAGGTGATGCCGACTTTTACCAGTTTGGCACCTTGATGCAAATAGTC
GACTACCAACACTTGCCTGATGGCCGCAGCCTGGTTGAGTCCAAGGGCCTGTCGCGCTTCCGCGTGGTAACCTTT
TCACGCGTCGACGGCTATTCCGTGGGAAAAGCGCTTCGCATCGACGACGTCGGCCTGCAGCAAGAAGAGGCCTTG
GAGCTGGCCGAAGTCGGCTACGACGTCAGCGATAGCGCAGCAGGAAGTCGTGCTGCCGACGCCGAGATGACGGAT
CCCACGTCGACCAGTGAGACGTCGTTTTGGTCCTCGTTGTGCCAGTTCGGGTCCGAGCTGCCTCAGTCCACCATG
GACCTTCACGCCATGACGACGCAGAGTCTGGCGCGCTTCGTCCTCGGCTTTGTCGACCGTACCAAAGAGAAACAG
CTGCCGTGGCTGACGGATCGTGTCCTCCGGACCTACGGCTCCTGTCCTACCGATCCGGCCGCTGTTCCATGGTGG
TTGGGCAGTACGATGCCCGTCCCCATAGAGCAGAGATACGAGCTACTCAACACGCACACTGTCCGCGACCGGCTA
AAGATATGCGGCTGGTGGATTCTCAATGTCAGGGACTGGTCCAAGAGGTGA
Transcript >Ophun1|2435
ATGTCCACAGATCTGCCAGATGCGGACGCCTCGCTTCCTCCGCCGGAACCCCCCGCCAGCGGACAGAACCAGCCG
ATGCTCGACGCCTCTATCTTCAGAGAGAATCCGCTGGCAAACTCGGGGCCTTCTAACACTCAGGCCCGCGACATA
GTCCGCCTATTCCAATGTCACGTCTGCTCGGCCCCCTACGAGCACATCATCAGCCTCCCCTGCGGCGGAAGCATC
TGCAGGACCTGCATGCCTGTGCCTTTCATCCGTACGGGTGTCAGCTTCCCGGCCTCGGAACATCGACGCGAGGGC
TTCATCTGCCCCTATGAAGACTGCGAAAAGGTGCACGCCGTCGTCGACTGCGGCACTGACATCATACTCAACAAG
GTGGCCGAAATCGTCCAAGCCGAGATGAAGCGCGGCATCGACGACGCAGCCAGACTCGAATTGTCGGTGCGCATC
AAGCTCTTCAATTGGAGTGAGGATGAGTCCCCTTCGCCCACAGACGGCCTTCTCATGGGCGGCTCTCGCCTGATG
GCCACCTGGGCTTTGGCAGCTCAGAGAAAGCTCCCCTTCGACGCCGACGTCGTCGTCTGTGACGAGGGCCAGCAG
AACGACGAGTGCGATTACAGCGTCATCGGAGCGCTGCAAAAGACGCTGCGTGCCGAGATGGACTGTCAGATCTGC
TACTCGCTCTTGTACGATCCCTTGACGGCCGAATGTGGCCACACCTTTTGTCGATCCTGTCTTCTCCGCGTCTTC
GTCGTCAACCGCCGCTGTCCCATGTGTCGGCGTGACCTCTGCATCGATCCTCAACTGCAACCCTACGTCTGTCCG
CCAAACGACCGCATCCTCGAAATCACCGAGACGTTCTGGGAAGATGAGTTGAAGGCTCGGGGACAGGCTATGGCT
GCCGAGGCCGGGTCGTCTGATGATTACGTCCTGATCCCGCTCTTCATCTGCGGCCTGGTCTTTCCCACCATGCCC
TTGATTCTGAACGTGTTCGAAGAGCACTACAGGGTCATGATTCGGCGTGTCATCGAGGGCGACATGACGTTTGGC
GTCGTCATGCCGCGCTCGCCGGATCATCAAGGTGATGCCGACTTTTACCAGTTTGGCACCTTGATGCAAATAGTC
GACTACCAACACTTGCCTGATGGCCGCAGCCTGGTTGAGTCCAAGGGCCTGTCGCGCTTCCGCGTGGTAACCTTT
TCACGCGTCGACGGCTATTCCGTGGGAAAAGCGCTTCGCATCGACGACGTCGGCCTGCAGCAAGAAGAGGCCTTG
GAGCTGGCCGAAGTCGGCTACGACGTCAGCGATAGCGCAGCAGGAAGTCGTGCTGCCGACGCCGAGATGACGGAT
CCCACGTCGACCAGTGAGACGTCGTTTTGGTCCTCGTTGTGCCAGTTCGGGTCCGAGCTGCCTCAGTCCACCATG
GACCTTCACGCCATGACGACGCAGAGTCTGGCGCGCTTCGTCCTCGGCTTTGTCGACCGTACCAAAGAGAAACAG
CTGCCGTGGCTGACGGATCGTGTCCTCCGGACCTACGGCTCCTGTCCTACCGATCCGGCCGCTGTTCCATGGTGG
TTGGGCAGTACGATGCCCGTCCCCATAGAGCAGAGATACGAGCTACTCAACACGCACACTGTCCGCGACCGGCTA
AAGATATGCGGCTGGTGGATTCTCAATGTCAGGGACTGGTCCAAGAGGTGA
Gene >Ophun1|2435
ATGTCCACAGATCTGCCAGATGCGGACGCCTCGCTTCCTCCGCCGGAACCCCCCGCCAGCGGACAGAACCAGCCG
ATGCTCGACGCCTCTATCTTCAGAGAGAATCCGCTGGCAAACTCGGGGCCTTCTAACACTCAGGCCCGCGACATA
GTCCGCCTATTCCAATGTCACGTCTGCTCGGCCCCCTACGAGCACATCATCAGCCTCCCCTGCGGCGGAAGCATC
TGCAGGACCTGCATGCCTGTGCCTTTCATCCGTACGGGTGTCAGCTTCCCGGCCTCGGAACATCGACGCGAGGGC
TTCATCTGCCCCTATGAAGACTGCGAAAAGGTGCACGCCGTCGTCGACTGCGGCACTGACATCATACTCAACAAG
GTGGCCGAAATCGTCCAAGCCGAGATGAAGCGCGGCATCGACGACGCAGCCAGACTCGAATTGTCGGTGCGCATC
AAGCTCTTCAATTGGAGTGAGGATGAGTCCCCTTCGCCCACAGACGGCCTTCTCATGGGCGGCTCTCGCCTGATG
GCCACCTGGGCTTTGGCAGCTCAGAGAAAGCTCCCCTTCGACGCCGACGTCGTCGTCTGTGACGAGGGCCAGCAG
AACGACGAGTGCGATTACAGCGTCATCGGAGCGCTGCAAAAGACGCTGCGTGCCGAGATGGACTGTCAGATCTGC
TACTCGCTCTTGTACGATCCCTTGACGGCCGAATGTGGCCACACCTTTTGTCGATCCTGTCTTCTCCGCGTCTTC
GTCGTCAACCGCCGCTGTCCCATGTGTCGGCGTGACCTCTGCATCGATCCTCAACTGCAACCCTACGTCTGTCCG
CCAAACGACCGCATCCTCGAAATCACCGAGACGTTCTGGGAAGATGAGTTGAAGGCTCGGGGACAGGCTATGGCT
GCCGAGGCCGGGTCGTCTGATGATTACGTCCTGATCCCGCTCTTCATCTGCGGCCTGGTCTTTCCCACCATGCCC
TTGATTCTGAACGTGTTCGAAGAGCACTACAGGGTCATGATTCGGCGTGTCATCGAGGGCGACATGACGTTTGGC
GTCGTCATGCCGCGCTCGCCGGATCATCAAGGTGATGCCGACTTTTACCAGTTTGGCACCTTGATGCAAATAGTC
GACTACCAACACTTGCCTGATGGCCGCAGCCTGGTTGAGTCCAAGGGCCTGTCGCGCTTCCGCGTGGTAACCTTT
TCACGCGTCGACGGCTATTCCGTGGGAAAAGCGCTTCGCATCGACGACGTCGGCCTGCAGCAAGAAGAGGCCTTG
GAGCTGGCCGAAGTCGGCTACGACGTCAGCGATAGCGCAGCAGGAAGTCGTGCTGCCGACGCCGAGATGACGGAT
CCCACGTCGACCAGTGAGACGTCGTTTTGGTCCTCGTTGTGCCAGTTCGGGTCCGAGCTGCCTCAGTCCACCATG
GACCTTCACGCCATGACGACGCAGAGTCTGGCGCGCTTCGTCCTCGGCTTTGTCGACCGTACCAAAGAGAAACAG
CTGCCGTGGCTGACGGATCGTGTCCTCCGGACCTACGGCTCCTGTCCTACCGATCCGGCCGCTGTTCCATGGTGG
TTGGGCAGTACGATGCCCGTCCCCATAGAGCAGAGATACGAGCTACTCAACACGCACACTGTCCGCGACCGGCTA
AAGATATGCGGCTGGTGGATTCTCAATGTCAGGGACTGGTCCAAGAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail