Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2432
Gene name
LocationContig_22:53213..56026
Strand+
Gene length (bp)2813
Transcript length (bp)2478
Coding sequence length (bp)2478
Protein length (aa) 826

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 3.2E-35 56 281
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 3.3E-24 53 278

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43066|PPK30_SCHPO Serine/threonine-protein kinase ppk30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk30 PE=1 SV=1 42 335 8.0E-104
sp|P53974|ARK1_YEAST Actin-regulating kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARK1 PE=1 SV=1 37 332 5.0E-101
sp|P40494|PRK1_YEAST Actin-regulating kinase PRK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRK1 PE=1 SV=1 39 377 5.0E-97
sp|Q9USS2|PPK29_SCHPO Serine/threonine-protein kinase ppk29 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk29 PE=1 SV=1 42 336 4.0E-95
sp|Q9UU85|PPK38_SCHPO Protein kinase domain-containing protein ppk38 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk38 PE=3 SV=1 33 336 5.0E-90
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43066|PPK30_SCHPO Serine/threonine-protein kinase ppk30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk30 PE=1 SV=1 42 335 8.0E-104
sp|P53974|ARK1_YEAST Actin-regulating kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARK1 PE=1 SV=1 37 332 5.0E-101
sp|P40494|PRK1_YEAST Actin-regulating kinase PRK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRK1 PE=1 SV=1 39 377 5.0E-97
sp|Q9USS2|PPK29_SCHPO Serine/threonine-protein kinase ppk29 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk29 PE=1 SV=1 42 336 4.0E-95
sp|Q9UU85|PPK38_SCHPO Protein kinase domain-containing protein ppk38 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk38 PE=3 SV=1 33 336 5.0E-90
sp|Q5A961|PRK1_CANAL Actin-regulating kinase PRK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRK1 PE=1 SV=1 32 328 4.0E-88
sp|P38080|AKL1_YEAST Serine/threonine-protein kinase AKL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AKL1 PE=1 SV=1 39 333 6.0E-84
sp|Q2M2I8|AAK1_HUMAN AP2-associated protein kinase 1 OS=Homo sapiens GN=AAK1 PE=1 SV=3 42 348 1.0E-63
sp|F1SPM8|AAK1_PIG AP2-associated protein kinase 1 OS=Sus scrofa GN=AAK1 PE=2 SV=2 42 348 3.0E-63
sp|Q9NSY1|BMP2K_HUMAN BMP-2-inducible protein kinase OS=Homo sapiens GN=BMP2K PE=1 SV=2 47 348 6.0E-63
sp|F1MH24|AAK1_BOVIN AP2-associated protein kinase 1 OS=Bos taurus GN=AAK1 PE=1 SV=2 42 347 7.0E-63
sp|Q3UHJ0|AAK1_MOUSE AP2-associated protein kinase 1 OS=Mus musculus GN=Aak1 PE=1 SV=2 42 348 9.0E-63
sp|P0C1X8|AAK1_RAT AP2-associated protein kinase 1 OS=Rattus norvegicus GN=Aak1 PE=1 SV=1 42 347 1.0E-62
sp|Q54VV7|Y0111_DICDI Probable serine/threonine-protein kinase DDB_G0280111 OS=Dictyostelium discoideum GN=DDB_G0280111 PE=3 SV=1 42 326 8.0E-62
sp|Q91Z96|BMP2K_MOUSE BMP-2-inducible protein kinase OS=Mus musculus GN=Bmp2k PE=1 SV=1 47 332 2.0E-61
sp|Q86HW6|Y6461_DICDI Probable serine/threonine-protein kinase DDB_G0276461 OS=Dictyostelium discoideum GN=DDB_G0276461 PE=3 SV=1 42 298 5.0E-54
sp|G5ECQ3|SEL5_CAEEL Protein sel-5 OS=Caenorhabditis elegans GN=sel-5 PE=2 SV=1 42 315 3.0E-47
sp|O14976|GAK_HUMAN Cyclin-G-associated kinase OS=Homo sapiens GN=GAK PE=1 SV=2 42 310 1.0E-41
sp|P97874|GAK_RAT Cyclin-G-associated kinase OS=Rattus norvegicus GN=Gak PE=1 SV=1 42 318 3.0E-41
sp|Q99KY4|GAK_MOUSE Cyclin-G-associated kinase OS=Mus musculus GN=Gak PE=1 SV=2 42 318 2.0E-40
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 56 317 1.0E-20
sp|Q12003|ENV7_YEAST Serine/threonine-protein kinase ENV7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENV7 PE=1 SV=1 39 310 7.0E-20
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 58 330 1.0E-19
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 54 317 1.0E-19
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 54 330 3.0E-19
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 54 330 2.0E-18
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 53 276 3.0E-18
sp|Q54RJ4|IKSA_DICDI Probable serine/threonine-protein kinase iksA OS=Dictyostelium discoideum GN=iksA PE=3 SV=1 58 279 3.0E-18
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 52 288 6.0E-18
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 52 288 1.0E-17
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 54 330 1.0E-17
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 58 275 2.0E-17
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 91 295 2.0E-17
sp|O01700|DLK1_CAEEL Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis elegans GN=dlk-1 PE=1 SV=4 84 328 7.0E-17
sp|Q8NG66|NEK11_HUMAN Serine/threonine-protein kinase Nek11 OS=Homo sapiens GN=NEK11 PE=1 SV=2 51 317 1.0E-16
sp|Q10078|PPK13_SCHPO Serine/threonine-protein kinase ppk13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk13 PE=3 SV=2 45 308 1.0E-16
sp|Q8C0Q4|NEK11_MOUSE Serine/threonine-protein kinase Nek11 OS=Mus musculus GN=Nek11 PE=2 SV=2 51 284 3.0E-16
sp|Q0IHQ8|STK10_XENTR Serine/threonine-protein kinase 10 OS=Xenopus tropicalis GN=stk10 PE=2 SV=1 58 320 5.0E-16
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 34 331 6.0E-16
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 54 330 7.0E-16
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 54 293 1.0E-15
sp|B4LDJ6|PLK4_DROVI Serine/threonine-protein kinase PLK4 OS=Drosophila virilis GN=SAK PE=3 SV=1 54 318 1.0E-15
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 50 276 1.0E-15
sp|Q38871|CDPK5_ARATH Calcium-dependent protein kinase 5 OS=Arabidopsis thaliana GN=CPK5 PE=2 SV=1 54 401 2.0E-15
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 93 318 2.0E-15
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 3 279 2.0E-15
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 50 276 3.0E-15
sp|Q55GC2|DST2_DICDI Serine/threonine-protein kinase dst2 OS=Dictyostelium discoideum GN=dst2 PE=3 SV=1 58 303 3.0E-15
sp|A8X775|DLK1_CAEBR Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis briggsae GN=dlk-1 PE=3 SV=1 84 328 3.0E-15
sp|B4J3F1|PLK4_DROGR Serine/threonine-protein kinase PLK4 OS=Drosophila grimshawi GN=SAK PE=3 SV=1 54 318 4.0E-15
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 58 331 4.0E-15
sp|Q8WNU8|NEK11_MACFA Serine/threonine-protein kinase Nek11 OS=Macaca fascicularis GN=NEK11 PE=2 SV=1 51 317 4.0E-15
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 54 291 5.0E-15
sp|Q8VZJ9|CRCK2_ARATH Calmodulin-binding receptor-like cytoplasmic kinase 2 OS=Arabidopsis thaliana GN=CRCK2 PE=2 SV=1 58 280 6.0E-15
sp|Q9LJL9|CAMK2_ARATH CDPK-related kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=1 SV=1 93 316 7.0E-15
sp|C0LGD6|Y1570_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g05700 OS=Arabidopsis thaliana GN=At1g05700 PE=2 SV=1 22 268 7.0E-15
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 58 297 1.0E-14
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 21 299 2.0E-14
sp|Q38872|CDPK6_ARATH Calcium-dependent protein kinase 6 OS=Arabidopsis thaliana GN=CPK6 PE=1 SV=1 54 401 2.0E-14
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 42 343 2.0E-14
sp|Q6CSX2|ATG1_KLULA Serine/threonine-protein kinase ATG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG1 PE=3 SV=1 45 284 2.0E-14
sp|B4KYX8|PLK4_DROMO Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis GN=SAK PE=3 SV=1 54 318 2.0E-14
sp|Q2LYK3|PLK4_DROPS Serine/threonine-protein kinase PLK4 OS=Drosophila pseudoobscura pseudoobscura GN=SAK PE=3 SV=1 54 319 2.0E-14
sp|B4HBU3|PLK4_DROPE Serine/threonine-protein kinase PLK4 OS=Drosophila persimilis GN=SAK PE=3 SV=1 54 319 2.0E-14
sp|Q9ASQ5|CRCK3_ARATH Calmodulin-binding receptor-like cytoplasmic kinase 3 OS=Arabidopsis thaliana GN=CRCK3 PE=2 SV=1 4 276 3.0E-14
sp|B4MXR8|PLK4_DROWI Serine/threonine-protein kinase PLK4 OS=Drosophila willistoni GN=SAK PE=3 SV=1 54 311 3.0E-14
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 43 328 3.0E-14
sp|B7ZR30|STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis GN=stk10-a PE=1 SV=1 58 284 3.0E-14
sp|O13839|FIN1_SCHPO G2-specific protein kinase fin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fin1 PE=3 SV=1 54 317 3.0E-14
sp|Q75CH3|ATG1_ASHGO Serine/threonine-protein kinase ATG1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG1 PE=3 SV=1 40 284 3.0E-14
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 53 306 4.0E-14
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 53 311 4.0E-14
sp|Q8LEB6|Y5185_ARATH Probable receptor-like protein kinase At5g18500 OS=Arabidopsis thaliana GN=At5g18500 PE=2 SV=1 3 265 4.0E-14
sp|F1NBT0|STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus GN=STK10 PE=3 SV=2 58 309 5.0E-14
sp|O88697|STK16_MOUSE Serine/threonine-protein kinase 16 OS=Mus musculus GN=Stk16 PE=1 SV=3 40 276 5.0E-14
sp|O45818|DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans GN=dkf-2 PE=1 SV=4 42 294 6.0E-14
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 56 318 6.0E-14
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 14 297 6.0E-14
sp|Q8BHI9|NIM1_MOUSE Serine/threonine-protein kinase NIM1 OS=Mus musculus GN=Nim1k PE=2 SV=1 46 293 6.0E-14
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 47 276 6.0E-14
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 58 293 7.0E-14
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 40 297 7.0E-14
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 47 276 8.0E-14
sp|Q6AVM3|CCAMK_ORYSJ Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Oryza sativa subsp. japonica GN=CCAMK PE=2 SV=1 53 293 8.0E-14
sp|Q869N2|PAKB_DICDI Serine/threonine-protein kinase pakB OS=Dictyostelium discoideum GN=pakB PE=1 SV=1 58 275 9.0E-14
sp|Q9FIL7|CRCK1_ARATH Calmodulin-binding receptor-like cytoplasmic kinase 1 OS=Arabidopsis thaliana GN=CRCK1 PE=1 SV=1 58 276 1.0E-13
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 43 328 1.0E-13
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 29 293 1.0E-13
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 58 292 1.0E-13
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 51 310 1.0E-13
sp|Q8K1Y2|KPCD3_MOUSE Serine/threonine-protein kinase D3 OS=Mus musculus GN=Prkd3 PE=1 SV=1 8 315 1.0E-13
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 50 294 1.0E-13
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 29 293 1.0E-13
sp|Q1PE17|CDPKI_ARATH Calcium-dependent protein kinase 18 OS=Arabidopsis thaliana GN=CPK18 PE=2 SV=1 37 293 1.0E-13
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 53 289 1.0E-13
sp|Q9HFF4|PPK1_SCHPO Serine/threonine-protein kinase ppk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk1 PE=1 SV=2 82 277 1.0E-13
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 50 294 1.0E-13
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 45 310 1.0E-13
sp|Q8T0S6|HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster GN=hpo PE=1 SV=1 54 294 1.0E-13
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 54 268 2.0E-13
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 47 276 2.0E-13
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 50 294 2.0E-13
sp|Q90XC2|NEK8_DANRE Serine/threonine-protein kinase Nek8 OS=Danio rerio GN=nek8 PE=2 SV=1 56 365 2.0E-13
sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota GN=CRK PE=2 SV=1 42 297 2.0E-13
sp|O75716|STK16_HUMAN Serine/threonine-protein kinase 16 OS=Homo sapiens GN=STK16 PE=1 SV=4 40 276 2.0E-13
sp|Q9FX86|CAMK8_ARATH CDPK-related kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=1 93 297 2.0E-13
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 50 294 2.0E-13
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 45 310 2.0E-13
sp|Q43531|CCAMK_LILLO Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lilium longiflorum GN=CCAMK PE=1 SV=1 83 293 2.0E-13
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 47 276 2.0E-13
sp|O61125|STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum GN=krsA PE=1 SV=1 54 263 2.0E-13
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 49 303 2.0E-13
sp|Q9SG12|CAMK6_ARATH CDPK-related kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1 93 289 3.0E-13
sp|Q7Z2Y5|NRK_HUMAN Nik-related protein kinase OS=Homo sapiens GN=NRK PE=1 SV=2 28 263 3.0E-13
sp|P57760|STK16_RAT Serine/threonine-protein kinase 16 OS=Rattus norvegicus GN=Stk16 PE=2 SV=2 40 276 3.0E-13
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 58 293 3.0E-13
sp|Q8IY84|NIM1_HUMAN Serine/threonine-protein kinase NIM1 OS=Homo sapiens GN=NIM1K PE=1 SV=1 46 300 4.0E-13
sp|Q9SZM3|CDPKQ_ARATH Calcium-dependent protein kinase 26 OS=Arabidopsis thaliana GN=CPK26 PE=2 SV=1 58 401 4.0E-13
sp|Q9FIM9|CAMK4_ARATH CDPK-related kinase 4 OS=Arabidopsis thaliana GN=CRK4 PE=2 SV=1 82 289 4.0E-13
sp|Q9ZUZ2|CAMK3_ARATH CDPK-related kinase 3 OS=Arabidopsis thaliana GN=CRK3 PE=1 SV=1 82 294 4.0E-13
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 53 306 4.0E-13
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 54 320 4.0E-13
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 56 330 4.0E-13
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 54 320 5.0E-13
sp|B3NE99|PLK4_DROER Serine/threonine-protein kinase PLK4 OS=Drosophila erecta GN=SAK PE=3 SV=1 54 285 5.0E-13
sp|Q5KQF5|CIPKM_ORYSJ CBL-interacting protein kinase 22 OS=Oryza sativa subsp. japonica GN=CIPK22 PE=2 SV=1 100 293 5.0E-13
sp|B4PDM5|PLK4_DROYA Serine/threonine-protein kinase PLK4 OS=Drosophila yakuba GN=SAK PE=3 SV=1 54 285 5.0E-13
sp|B4IAQ8|PLK4_DROSE Serine/threonine-protein kinase PLK4 OS=Drosophila sechellia GN=SAK PE=3 SV=1 54 285 5.0E-13
sp|A5A7I8|CDPK5_SOLTU Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 6 311 6.0E-13
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 57 284 6.0E-13
sp|Q15139|KPCD1_HUMAN Serine/threonine-protein kinase D1 OS=Homo sapiens GN=PRKD1 PE=1 SV=2 50 315 6.0E-13
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopus laevis GN=stk4 PE=2 SV=1 53 302 6.0E-13
sp|G5EGQ3|MAX2_CAEEL Serine/threonine-protein kinase max-2 OS=Caenorhabditis elegans GN=max-2 PE=1 SV=1 32 275 6.0E-13
sp|Q91ZR4|NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 56 288 7.0E-13
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 58 310 7.0E-13
sp|Q9WTQ1|KPCD1_RAT Serine/threonine-protein kinase D1 OS=Rattus norvegicus GN=Prkd1 PE=1 SV=2 58 315 7.0E-13
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 53 293 7.0E-13
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 9 300 8.0E-13
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 42 311 8.0E-13
sp|Q62101|KPCD1_MOUSE Serine/threonine-protein kinase D1 OS=Mus musculus GN=Prkd1 PE=1 SV=2 58 315 8.0E-13
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 54 310 8.0E-13
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 56 288 9.0E-13
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 53 306 1.0E-12
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 58 291 1.0E-12
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 131 284 1.0E-12
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 53 286 1.0E-12
sp|O94806|KPCD3_HUMAN Serine/threonine-protein kinase D3 OS=Homo sapiens GN=PRKD3 PE=1 SV=1 8 315 1.0E-12
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 53 306 1.0E-12
sp|Q54RR9|Y9844_DICDI Probable serine/threonine-protein kinase DDB_G0282963 OS=Dictyostelium discoideum GN=DDB_G0282963 PE=3 SV=1 47 283 1.0E-12
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 53 306 1.0E-12
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 54 298 1.0E-12
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 53 306 1.0E-12
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 53 263 1.0E-12
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 53 306 1.0E-12
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 53 306 1.0E-12
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 42 294 1.0E-12
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 58 293 1.0E-12
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 54 276 1.0E-12
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 42 331 2.0E-12
sp|Q08CW1|TLK2_XENTR Serine/threonine-protein kinase tousled-like 2 OS=Xenopus tropicalis GN=tlk2 PE=2 SV=1 134 284 2.0E-12
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 96 278 2.0E-12
sp|D3ZGQ5|NEK8_RAT Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 56 288 2.0E-12
sp|Q5UQ78|YR517_MIMIV Putative serine/threonine-protein kinase R517/R518 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R517 PE=3 SV=2 58 298 2.0E-12
sp|Q9V3Q6|M3K7_DROME Mitogen-activated protein kinase kinase kinase 7 OS=Drosophila melanogaster GN=Tak1 PE=2 SV=1 95 276 2.0E-12
sp|Q7ZZC8|NEK9_XENLA Serine/threonine-protein kinase Nek9 OS=Xenopus laevis GN=nek9 PE=2 SV=1 80 276 2.0E-12
sp|B3M6I4|PLK4_DROAN Serine/threonine-protein kinase PLK4 OS=Drosophila ananassae GN=SAK PE=3 SV=1 54 285 2.0E-12
sp|Q86UE8|TLK2_HUMAN Serine/threonine-protein kinase tousled-like 2 OS=Homo sapiens GN=TLK2 PE=1 SV=2 134 284 2.0E-12
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 96 276 2.0E-12
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 58 293 2.0E-12
sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopus tropicalis GN=stk4 PE=2 SV=1 53 302 2.0E-12
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 96 276 2.0E-12
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 46 318 2.0E-12
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 46 318 2.0E-12
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 15 310 2.0E-12
sp|G4SLH0|TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans GN=ttn-1 PE=1 SV=2 51 302 2.0E-12
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 15 310 2.0E-12
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 15 310 3.0E-12
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 54 316 3.0E-12
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 54 316 3.0E-12
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 46 318 3.0E-12
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 19 276 3.0E-12
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 46 318 3.0E-12
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 54 298 3.0E-12
sp|O97143|PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster GN=SAK PE=1 SV=1 54 285 3.0E-12
sp|O42626|NRC2_NEUCR Serine/threonine-protein kinase nrc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nrc-2 PE=3 SV=1 44 293 3.0E-12
sp|B4QK53|PLK4_DROSI Serine/threonine-protein kinase PLK4 OS=Drosophila simulans GN=SAK PE=3 SV=1 54 285 3.0E-12
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 43 310 3.0E-12
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 89 284 3.0E-12
sp|A2QIL5|ATG1_ASPNC Serine/threonine-protein kinase atg1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg1 PE=3 SV=1 58 370 3.0E-12
sp|O55047|TLK2_MOUSE Serine/threonine-protein kinase tousled-like 2 OS=Mus musculus GN=Tlk2 PE=1 SV=2 134 284 3.0E-12
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 58 276 3.0E-12
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 13 285 3.0E-12
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 44 310 3.0E-12
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 46 318 3.0E-12
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 12 292 4.0E-12
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 46 316 4.0E-12
sp|P48562|CLA4_YEAST Serine/threonine-protein kinase CLA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLA4 PE=1 SV=1 100 284 4.0E-12
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 58 280 4.0E-12
sp|Q42479|CDPK3_ARATH Calcium-dependent protein kinase 3 OS=Arabidopsis thaliana GN=CPK3 PE=1 SV=1 58 310 4.0E-12
sp|A7SNN5|PLK4_NEMVE Serine/threonine-protein kinase PLK4 OS=Nematostella vectensis GN=v1g246408 PE=3 SV=1 58 318 5.0E-12
sp|Q9SSF8|CDPKU_ARATH Calcium-dependent protein kinase 30 OS=Arabidopsis thaliana GN=CPK30 PE=1 SV=1 7 290 5.0E-12
sp|Q8RWC9|CIPK1_ARATH CBL-interacting serine/threonine-protein kinase 1 OS=Arabidopsis thaliana GN=CIPK1 PE=1 SV=2 58 295 5.0E-12
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 54 286 5.0E-12
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 58 293 5.0E-12
sp|Q9BZL6|KPCD2_HUMAN Serine/threonine-protein kinase D2 OS=Homo sapiens GN=PRKD2 PE=1 SV=2 50 294 5.0E-12
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 54 310 5.0E-12
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 113 310 5.0E-12
sp|Q28824|MYLK_BOVIN Myosin light chain kinase, smooth muscle OS=Bos taurus GN=MYLK PE=1 SV=1 96 323 6.0E-12
sp|Q8BZ03|KPCD2_MOUSE Serine/threonine-protein kinase D2 OS=Mus musculus GN=Prkd2 PE=1 SV=1 50 294 6.0E-12
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 58 289 6.0E-12
sp|P13186|KIN2_YEAST Serine/threonine-protein kinase KIN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN2 PE=1 SV=3 44 310 6.0E-12
sp|Q7SY52|STK10_DANRE Serine/threonine-protein kinase 10 OS=Danio rerio GN=stk10 PE=2 SV=1 58 284 6.0E-12
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 58 289 6.0E-12
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 131 408 7.0E-12
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 131 408 7.0E-12
sp|Q8C0V0|TLK1_MOUSE Serine/threonine-protein kinase tousled-like 1 OS=Mus musculus GN=Tlk1 PE=1 SV=2 134 297 7.0E-12
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 54 286 7.0E-12
sp|A5A7I7|CDPK4_SOLTU Calcium-dependent protein kinase 4 OS=Solanum tuberosum GN=CPK4 PE=2 SV=1 58 299 7.0E-12
sp|Q9UKI8|TLK1_HUMAN Serine/threonine-protein kinase tousled-like 1 OS=Homo sapiens GN=TLK1 PE=1 SV=2 134 297 7.0E-12
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 54 310 7.0E-12
sp|Q5XIS9|KPCD2_RAT Serine/threonine-protein kinase D2 OS=Rattus norvegicus GN=Prkd2 PE=1 SV=1 50 294 7.0E-12
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 131 284 8.0E-12
sp|Q54QQ1|PHG2_DICDI Serine/threonine-protein kinase phg2 OS=Dictyostelium discoideum GN=phg2 PE=1 SV=1 130 278 8.0E-12
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 54 310 8.0E-12
sp|Q9GT24|ZYG1_CAEEL Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis elegans GN=zyg-1 PE=1 SV=1 42 268 8.0E-12
sp|Q1ECX4|TLK2_DANRE Serine/threonine-protein kinase tousled-like 2 OS=Danio rerio GN=tlk2 PE=2 SV=2 134 284 8.0E-12
sp|O08815|SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus GN=Slk PE=1 SV=1 58 317 8.0E-12
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 54 310 8.0E-12
sp|Q86YV6|MYLK4_HUMAN Myosin light chain kinase family member 4 OS=Homo sapiens GN=MYLK4 PE=1 SV=2 26 275 8.0E-12
sp|Q6FL58|ATG1_CANGA Serine/threonine-protein kinase ATG1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG1 PE=3 SV=1 44 284 9.0E-12
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 99 307 9.0E-12
sp|A7J1T0|M313B_XENLA Mitogen-activated protein kinase kinase kinase 13-B OS=Xenopus laevis GN=map3k13-b PE=2 SV=1 56 284 9.0E-12
sp|Q9LET1|CAMK7_ARATH CDPK-related kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=1 SV=1 75 289 9.0E-12
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 61 284 9.0E-12
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 54 277 9.0E-12
sp|P51955|NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens GN=NEK2 PE=1 SV=1 99 317 9.0E-12
sp|E1BK52|STK10_BOVIN Serine/threonine-protein kinase 10 OS=Bos taurus GN=STK10 PE=3 SV=3 58 284 9.0E-12
sp|O54988|SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus GN=Slk PE=1 SV=2 58 317 1.0E-11
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 54 275 1.0E-11
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 9 285 1.0E-11
sp|O94804|STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens GN=STK10 PE=1 SV=1 58 309 1.0E-11
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 27 298 1.0E-11
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 85 281 1.0E-11
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 54 316 1.0E-11
sp|Q5R4K9|KPCI_PONAB Protein kinase C iota type OS=Pongo abelii GN=PRKCI PE=2 SV=2 47 279 1.0E-11
sp|P41743|KPCI_HUMAN Protein kinase C iota type OS=Homo sapiens GN=PRKCI PE=1 SV=2 47 279 1.0E-11
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1 OS=Oryza sativa subsp. japonica GN=CAMK1 PE=1 SV=1 75 301 1.0E-11
sp|P20689|MYLK2_RAT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Rattus norvegicus GN=Mylk2 PE=1 SV=2 100 275 1.0E-11
sp|O35942|NEK2_MOUSE Serine/threonine-protein kinase Nek2 OS=Mus musculus GN=Nek2 PE=1 SV=2 99 317 1.0E-11
sp|F1M7Y5|KPCI_RAT Protein kinase C iota type OS=Rattus norvegicus GN=Prkci PE=1 SV=1 47 279 1.0E-11
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 58 289 1.0E-11
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 58 292 1.0E-11
sp|O64556|Y2923_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g19230 OS=Arabidopsis thaliana GN=At2g19230 PE=3 SV=3 54 268 1.0E-11
sp|Q1DB00|MASK_MYXXD Tyrosine-protein kinase MasK OS=Myxococcus xanthus (strain DK 1622) GN=masK PE=1 SV=1 53 286 1.0E-11
sp|Q6PDN3|MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus GN=Mylk PE=1 SV=3 54 323 1.0E-11
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 131 293 1.0E-11
sp|P49138|MAPK2_MOUSE MAP kinase-activated protein kinase 2 OS=Mus musculus GN=Mapkapk2 PE=1 SV=2 98 342 1.0E-11
sp|Q8GVC7|PKZ1_PHYIN Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans GN=PKZ1 PE=1 SV=1 41 300 1.0E-11
sp|Q90XF2|KPCI_DANRE Protein kinase C iota type OS=Danio rerio GN=prkci PE=2 SV=2 54 279 1.0E-11
sp|Q9LRP3|Y3174_ARATH Probable receptor-like protein kinase At3g17420 OS=Arabidopsis thaliana GN=At3g17420 PE=1 SV=1 13 265 1.0E-11
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 50 275 2.0E-11
sp|Q62074|KPCI_MOUSE Protein kinase C iota type OS=Mus musculus GN=Prkci PE=1 SV=3 47 279 2.0E-11
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 77 275 2.0E-11
sp|A0AAR7|CCAMK_LOTJA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lotus japonicus GN=CCAMK PE=1 SV=1 83 290 2.0E-11
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 61 328 2.0E-11
sp|Q9USX7|PPK22_SCHPO Serine/threonine-protein kinase ppk22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk22 PE=1 SV=1 18 403 2.0E-11
sp|A6ZU08|TOS3_YEAS7 Serine/threonine-protein kinase TOS3 OS=Saccharomyces cerevisiae (strain YJM789) GN=TOS3 PE=3 SV=1 100 293 2.0E-11
sp|Q8N4C8|MINK1_HUMAN Misshapen-like kinase 1 OS=Homo sapiens GN=MINK1 PE=1 SV=2 97 263 2.0E-11
sp|B4GXC2|DCLK_DROPE Serine/threonine-protein kinase GL21140 OS=Drosophila persimilis GN=GL21140 PE=3 SV=1 54 331 2.0E-11
sp|P43637|TOS3_YEAST Serine/threonine-protein kinase TOS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOS3 PE=1 SV=1 100 293 2.0E-11
sp|P49136|MAPK2_CRILO MAP kinase-activated protein kinase 2 (Fragment) OS=Cricetulus longicaudatus GN=MAPKAPK2 PE=2 SV=1 98 342 2.0E-11
sp|F1LP90|MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus GN=Mink1 PE=1 SV=2 97 263 2.0E-11
sp|Q3E8W4|ANX2_ARATH Receptor-like protein kinase ANXUR2 OS=Arabidopsis thaliana GN=ANX2 PE=2 SV=1 15 269 2.0E-11
sp|B5DK35|DCLK_DROPS Serine/threonine-protein kinase GA29083 OS=Drosophila pseudoobscura pseudoobscura GN=GA29083 PE=3 SV=1 54 331 2.0E-11
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 54 296 2.0E-11
sp|A7J1T2|M313A_XENLA Mitogen-activated protein kinase kinase kinase 13-A OS=Xenopus laevis GN=map3k13-a PE=2 SV=1 56 284 2.0E-11
sp|Q9JM52|MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus GN=Mink1 PE=1 SV=3 97 263 2.0E-11
sp|Q9LTC0|Y5707_ARATH Probable receptor-like protein kinase At5g47070 OS=Arabidopsis thaliana GN=At5g47070 PE=1 SV=1 47 269 2.0E-11
sp|O88664|TAOK1_RAT Serine/threonine-protein kinase TAO1 OS=Rattus norvegicus GN=Taok1 PE=1 SV=1 58 269 2.0E-11
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 49 317 2.0E-11
sp|Q5F2E8|TAOK1_MOUSE Serine/threonine-protein kinase TAO1 OS=Mus musculus GN=Taok1 PE=1 SV=1 58 269 2.0E-11
sp|Q01919|KIN4_YEAST Serine/threonine-protein kinase KIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN4 PE=1 SV=1 53 277 2.0E-11
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 51 280 2.0E-11
sp|Q6PGN3|DCLK2_MOUSE Serine/threonine-protein kinase DCLK2 OS=Mus musculus GN=Dclk2 PE=1 SV=1 54 316 2.0E-11
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 44 332 2.0E-11
sp|O55092|SLK_CAVPO STE20-like serine/threonine-protein kinase OS=Cavia porcellus GN=SLK PE=1 SV=1 58 317 2.0E-11
sp|Q6RET6|CCAMK_PEA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (Fragment) OS=Pisum sativum GN=SYM9 PE=1 SV=2 83 290 2.0E-11
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 58 278 2.0E-11
sp|Q7L7X3|TAOK1_HUMAN Serine/threonine-protein kinase TAO1 OS=Homo sapiens GN=TAOK1 PE=1 SV=1 58 269 2.0E-11
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 46 280 3.0E-11
sp|A8KBH6|KPCB_XENTR Protein kinase C beta type OS=Xenopus tropicalis GN=prkcb PE=2 SV=1 56 291 3.0E-11
sp|O55098|STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus GN=Stk10 PE=1 SV=2 58 309 3.0E-11
sp|P41719|PK1_NPVHZ Serine/threonine-protein kinase 1 OS=Heliothis zea nuclear polyhedrosis virus GN=PK1 PE=3 SV=1 133 276 3.0E-11
sp|Q9JLM8|DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus GN=Dclk1 PE=1 SV=1 49 317 3.0E-11
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 75 263 3.0E-11
sp|P11799|MYLK_CHICK Myosin light chain kinase, smooth muscle OS=Gallus gallus GN=Mylk PE=1 SV=2 54 317 3.0E-11
sp|O04086|Y1105_ARATH Probable receptor-like protein kinase At1g11050 OS=Arabidopsis thaliana GN=At1g11050 PE=2 SV=1 55 268 3.0E-11
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 54 277 3.0E-11
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 54 277 3.0E-11
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 78 275 3.0E-11
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 5 276 3.0E-11
sp|Q6ZWH5|NEK10_HUMAN Serine/threonine-protein kinase Nek10 OS=Homo sapiens GN=NEK10 PE=2 SV=3 47 315 3.0E-11
sp|E9PTG8|STK10_RAT Serine/threonine-protein kinase 10 OS=Rattus norvegicus GN=Stk10 PE=1 SV=1 58 284 3.0E-11
sp|Q5N942|SAPK4_ORYSJ Serine/threonine-protein kinase SAPK4 OS=Oryza sativa subsp. japonica GN=SAPK4 PE=2 SV=2 131 293 3.0E-11
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 75 263 3.0E-11
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 46 280 3.0E-11
sp|P49137|MAPK2_HUMAN MAP kinase-activated protein kinase 2 OS=Homo sapiens GN=MAPKAPK2 PE=1 SV=1 98 342 3.0E-11
sp|Q66JF3|MKNK1_XENTR MAP kinase-interacting serine/threonine-protein kinase 1 OS=Xenopus tropicalis GN=mknk1 PE=2 SV=1 58 275 3.0E-11
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 54 277 3.0E-11
sp|O02827|MYLK_SHEEP Myosin light chain kinase, smooth muscle (Fragment) OS=Ovis aries GN=MYLK PE=2 SV=1 96 317 3.0E-11
sp|Q9LIG2|RLK6_ARATH Receptor-like protein kinase At3g21340 OS=Arabidopsis thaliana GN=At3g21340 PE=1 SV=1 54 268 3.0E-11
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 56 334 3.0E-11
sp|Q3U1V8|M3K9_MOUSE Mitogen-activated protein kinase kinase kinase 9 OS=Mus musculus GN=Map3k9 PE=2 SV=2 38 283 3.0E-11
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 49 317 3.0E-11
sp|C0LGR6|Y4291_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g29180 OS=Arabidopsis thaliana GN=At4g29180 PE=2 SV=2 43 268 3.0E-11
sp|P0C5D6|SAPK3_ORYSJ Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. japonica GN=SAPK3 PE=1 SV=1 133 293 3.0E-11
sp|A2ZAB5|SAPK3_ORYSI Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. indica GN=SAPK3 PE=1 SV=2 133 293 3.0E-11
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 46 280 4.0E-11
sp|P38691|KSP1_YEAST Serine/threonine-protein kinase KSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KSP1 PE=1 SV=1 100 280 4.0E-11
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 99 284 4.0E-11
sp|Q54JG7|DST4_DICDI Serine/threonine-protein kinase dst4 OS=Dictyostelium discoideum GN=dst4 PE=3 SV=1 97 263 4.0E-11
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 54 311 4.0E-11
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 51 310 4.0E-11
sp|Q9CAU7|NEK2_ARATH Serine/threonine-protein kinase Nek2 OS=Arabidopsis thaliana GN=NEK2 PE=2 SV=1 58 318 4.0E-11
sp|Q9FPR3|EDR1_ARATH Serine/threonine-protein kinase EDR1 OS=Arabidopsis thaliana GN=EDR1 PE=1 SV=1 44 286 4.0E-11
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 99 307 4.0E-11
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 89 284 4.0E-11
sp|Q54MV2|MRKB_DICDI Probable serine/threonine-protein kinase MARK-B OS=Dictyostelium discoideum GN=mrkB PE=3 SV=1 95 310 4.0E-11
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 54 298 4.0E-11
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 54 320 4.0E-11
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 54 289 4.0E-11
sp|P49139|MAPK2_RABIT MAP kinase-activated protein kinase 2 (Fragment) OS=Oryctolagus cuniculus GN=MAPKAPK2 PE=1 SV=2 98 342 4.0E-11
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 44 310 4.0E-11
sp|Q696W0|SPEG_DANRE Striated muscle preferentially expressed protein kinase OS=Danio rerio GN=speg PE=2 SV=1 131 278 4.0E-11
sp|Q6RET7|CCAMK_MEDTR Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 OS=Medicago truncatula GN=DMI3 PE=2 SV=1 83 290 4.0E-11
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 98 284 5.0E-11
sp|P80192|M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens GN=MAP3K9 PE=1 SV=3 38 283 5.0E-11
sp|Q23356|MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans GN=mig-15 PE=2 SV=3 75 263 5.0E-11
sp|P49025|CTRO_MOUSE Citron Rho-interacting kinase OS=Mus musculus GN=Cit PE=1 SV=3 19 298 5.0E-11
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 98 284 5.0E-11
sp|Q05609|CTR1_ARATH Serine/threonine-protein kinase CTR1 OS=Arabidopsis thaliana GN=CTR1 PE=1 SV=1 42 275 6.0E-11
sp|O80396|M2K3_ARATH Mitogen-activated protein kinase kinase 3 OS=Arabidopsis thaliana GN=MKK3 PE=1 SV=1 40 267 6.0E-11
sp|D0N4E2|PKZ1_PHYIT Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans (strain T30-4) GN=PKZ1 PE=3 SV=1 41 300 6.0E-11
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 58 275 6.0E-11
sp|C0LGG4|Y1518_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51860 OS=Arabidopsis thaliana GN=At1g51860 PE=2 SV=2 54 268 6.0E-11
sp|Q6BVA0|IPL1_DEBHA Spindle assembly checkpoint kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPL1 PE=3 SV=2 7 277 6.0E-11
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 56 278 6.0E-11
sp|B4IMC3|DCLK_DROSE Serine/threonine-protein kinase GM11705 OS=Drosophila sechellia GN=GM11705 PE=3 SV=1 54 298 6.0E-11
sp|Q55BN8|NEK2_DICDI Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum GN=nek2 PE=1 SV=1 58 280 6.0E-11
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 99 307 6.0E-11
sp|Q12152|YP150_YEAST Putative serine/threonine-protein kinase YPL150W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL150W PE=1 SV=1 39 317 7.0E-11
sp|P31325|PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus GN=Phkg2 PE=1 SV=1 84 284 7.0E-11
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 54 298 7.0E-11
sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2 58 280 7.0E-11
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 54 286 7.0E-11
sp|Q1HKZ5|M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus GN=Map3k13 PE=1 SV=1 133 284 7.0E-11
sp|P53104|ATG1_YEAST Serine/threonine-protein kinase ATG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG1 PE=1 SV=1 55 296 7.0E-11
sp|A6ZU07|ATG1_YEAS7 Serine/threonine-protein kinase ATG1 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG1 PE=3 SV=1 55 296 7.0E-11
sp|Q38870|CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 58 299 7.0E-11
sp|C0LGG3|Y5182_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51820 OS=Arabidopsis thaliana GN=At1g51820 PE=2 SV=1 54 268 7.0E-11
sp|H2L099|GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans GN=gck-1 PE=1 SV=1 55 320 7.0E-11
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 46 280 8.0E-11
sp|O64483|SIRK_ARATH Senescence-induced receptor-like serine/threonine-protein kinase OS=Arabidopsis thaliana GN=SIRK PE=2 SV=1 54 268 8.0E-11
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 89 284 8.0E-11
sp|Q54M77|ROCO8_DICDI Probable serine/threonine-protein kinase roco8 OS=Dictyostelium discoideum GN=roco8 PE=3 SV=1 92 277 8.0E-11
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 61 408 8.0E-11
sp|Q2QSL4|CDKF2_ORYSJ Putative cyclin-dependent kinase F-2 OS=Oryza sativa subsp. japonica GN=CDKF-2 PE=3 SV=1 58 288 8.0E-11
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 51 297 8.0E-11
sp|Q60DG4|NEK4_ORYSJ Serine/threonine-protein kinase Nek4 OS=Oryza sativa subsp. japonica GN=NEK4 PE=2 SV=1 100 317 8.0E-11
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 56 334 8.0E-11
sp|Q15746|MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens GN=MYLK PE=1 SV=4 96 323 9.0E-11
sp|Q0WPH8|NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana GN=NEK5 PE=1 SV=1 95 317 9.0E-11
sp|Q6BS08|ATG1_DEBHA Serine/threonine-protein kinase ATG1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG1 PE=3 SV=2 58 284 9.0E-11
sp|Q06850|CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana GN=CPK1 PE=1 SV=1 58 299 9.0E-11
sp|Q9HFW2|CLA4_ASHGO Serine/threonine-protein kinase CLA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CLA4 PE=3 SV=1 99 284 9.0E-11
sp|Q8R4V0|SGK3_RAT Serine/threonine-protein kinase Sgk3 OS=Rattus norvegicus GN=Sgk3 PE=1 SV=2 56 275 9.0E-11
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 56 334 1.0E-10
sp|P33973|PKN1_MYXXA Serine/threonine-protein kinase Pkn1 OS=Myxococcus xanthus GN=pkn1 PE=1 SV=1 41 286 1.0E-10
sp|Q9ERE3|SGK3_MOUSE Serine/threonine-protein kinase Sgk3 OS=Mus musculus GN=Sgk3 PE=1 SV=1 56 275 1.0E-10
sp|Q8BG48|ST17B_MOUSE Serine/threonine-protein kinase 17B OS=Mus musculus GN=Stk17b PE=1 SV=1 123 302 1.0E-10
sp|Q4G3H4|IKKA_DANRE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Danio rerio GN=chuk PE=1 SV=1 53 275 1.0E-10
sp|Q08942|NRKA_TRYBB Putative serine/threonine-protein kinase A OS=Trypanosoma brucei brucei GN=NRKA PE=2 SV=1 56 275 1.0E-10
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 54 286 1.0E-10
sp|Q6BNF3|STE20_DEBHA Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STE20 PE=3 SV=2 99 275 1.0E-10
sp|Q9P286|PAK7_HUMAN Serine/threonine-protein kinase PAK 7 OS=Homo sapiens GN=PAK7 PE=1 SV=1 58 268 1.0E-10
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 48 275 1.0E-10
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 61 275 1.0E-10
sp|Q7LZQ8|KPCB_XENLA Protein kinase C beta type OS=Xenopus laevis GN=prkcb PE=2 SV=1 56 291 1.0E-10
sp|O94768|ST17B_HUMAN Serine/threonine-protein kinase 17B OS=Homo sapiens GN=STK17B PE=1 SV=1 130 302 1.0E-10
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 61 275 1.0E-10
sp|Q5RFL3|M3K7_PONAB Mitogen-activated protein kinase kinase kinase 7 OS=Pongo abelii GN=MAP3K7 PE=2 SV=1 131 279 1.0E-10
sp|Q91XS8|ST17B_RAT Serine/threonine-protein kinase 17B OS=Rattus norvegicus GN=Stk17b PE=1 SV=1 130 302 1.0E-10
sp|P9WI83|PKNA_MYCTU Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknA PE=1 SV=1 49 283 1.0E-10
sp|P9WI82|PKNA_MYCTO Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknA PE=3 SV=1 49 283 1.0E-10
sp|A5TY85|PKNA_MYCTA Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pknA PE=1 SV=1 49 283 1.0E-10
sp|P65727|PKNA_MYCBO Serine/threonine-protein kinase PknA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknA PE=3 SV=1 49 283 1.0E-10
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 46 268 1.0E-10
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 61 275 1.0E-10
sp|O43318|M3K7_HUMAN Mitogen-activated protein kinase kinase kinase 7 OS=Homo sapiens GN=MAP3K7 PE=1 SV=1 131 279 1.0E-10
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 48 275 1.0E-10
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 61 275 1.0E-10
sp|Q4KTY1|KPSH1_PINFU Serine/threonine-protein kinase H1 homolog OS=Pinctada fucata GN=PSKH1 PE=2 SV=1 37 290 1.0E-10
sp|Q91YA2|KPSH1_MOUSE Serine/threonine-protein kinase H1 OS=Mus musculus GN=Pskh1 PE=2 SV=3 99 307 1.0E-10
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 100 337 1.0E-10
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 131 408 1.0E-10
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 48 275 1.0E-10
sp|Q8C015|PAK7_MOUSE Serine/threonine-protein kinase PAK 7 OS=Mus musculus GN=Pak7 PE=1 SV=1 58 268 1.0E-10
sp|A2VDU3|M3K7_BOVIN Mitogen-activated protein kinase kinase kinase 7 OS=Bos taurus GN=MAP3K7 PE=2 SV=1 131 279 1.0E-10
sp|D7UQM5|AURK_PATPE Aurora kinase OS=Patiria pectinifera GN=aur PE=1 SV=1 58 293 1.0E-10
sp|A7MBB4|M3K13_BOVIN Mitogen-activated protein kinase kinase kinase 13 OS=Bos taurus GN=MAP3K13 PE=2 SV=1 133 284 1.0E-10
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 86 275 2.0E-10
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 127 276 2.0E-10
sp|Q9H2G2|SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens GN=SLK PE=1 SV=1 58 317 2.0E-10
sp|Q12852|M3K12_HUMAN Mitogen-activated protein kinase kinase kinase 12 OS=Homo sapiens GN=MAP3K12 PE=1 SV=2 52 284 2.0E-10
sp|Q8BTW9|PAK4_MOUSE Serine/threonine-protein kinase PAK 4 OS=Mus musculus GN=Pak4 PE=1 SV=1 58 275 2.0E-10
sp|Q62073|M3K7_MOUSE Mitogen-activated protein kinase kinase kinase 7 OS=Mus musculus GN=Map3k7 PE=1 SV=1 131 279 2.0E-10
sp|Q07250|KCCS_MALDO Calcium/calmodulin-dependent serine/threonine-protein kinase OS=Malus domestica PE=2 SV=1 131 290 2.0E-10
sp|Q9SR05|ANX1_ARATH Receptor-like protein kinase ANXUR1 OS=Arabidopsis thaliana GN=ANX1 PE=2 SV=1 44 269 2.0E-10
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 50 275 2.0E-10
sp|Q65X23|WNK2_ORYSJ Probable serine/threonine-protein kinase WNK2 OS=Oryza sativa subsp. japonica GN=WNK2 PE=2 SV=1 58 277 2.0E-10
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 77 284 2.0E-10
sp|P0C8E4|M3K7_RAT Mitogen-activated protein kinase kinase kinase 7 OS=Rattus norvegicus GN=Map3k7 PE=1 SV=1 131 279 2.0E-10
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 77 284 2.0E-10
sp|D4A280|PAK7_RAT Serine/threonine-protein kinase PAK 7 OS=Rattus norvegicus GN=Pak7 PE=1 SV=1 58 268 2.0E-10
sp|P13185|KIN1_YEAST Serine/threonine protein kinase KIN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN1 PE=1 SV=3 44 320 2.0E-10
sp|Q90ZY6|TLK1B_DANRE Serine/threonine-protein kinase tousled-like 1-B OS=Danio rerio GN=tlk1b PE=2 SV=1 134 315 2.0E-10
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 77 284 2.0E-10
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 58 278 2.0E-10
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 44 310 2.0E-10
sp|O43283|M3K13_HUMAN Mitogen-activated protein kinase kinase kinase 13 OS=Homo sapiens GN=MAP3K13 PE=1 SV=1 133 284 2.0E-10
sp|Q9S2C0|PKSC_STRCO Serine/threonine-protein kinase PksC OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pksC PE=3 SV=1 51 286 2.0E-10
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 50 293 2.0E-10
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 58 276 2.0E-10
sp|A1Z9X0|APKC_DROME Atypical protein kinase C OS=Drosophila melanogaster GN=aPKC PE=1 SV=1 42 279 2.0E-10
sp|Q86HN7|PLK_DICDI Probable serine/threonine-protein kinase PLK OS=Dictyostelium discoideum GN=PLK PE=3 SV=1 56 317 2.0E-10
sp|Q8R4U9|SGK2_RAT Serine/threonine-protein kinase Sgk2 OS=Rattus norvegicus GN=Sgk2 PE=1 SV=2 130 275 2.0E-10
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 77 284 2.0E-10
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 54 310 2.0E-10
sp|P25341|KIN82_YEAST Serine/threonine-protein kinase KIN82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN82 PE=1 SV=3 56 276 2.0E-10
sp|Q5BKK4|SGK1_XENTR Serine/threonine-protein kinase Sgk1 OS=Xenopus tropicalis GN=sgk1 PE=2 SV=1 56 275 2.0E-10
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 51 303 2.0E-10
sp|Q5VST9|OBSCN_HUMAN Obscurin OS=Homo sapiens GN=OBSCN PE=1 SV=3 111 316 2.0E-10
sp|P53684|CDPKB_ORYSJ Calcium-dependent protein kinase isoform 11 OS=Oryza sativa subsp. japonica GN=CPK11 PE=2 SV=2 53 299 2.0E-10
sp|Q5R8X7|M3K13_PONAB Mitogen-activated protein kinase kinase kinase 13 OS=Pongo abelii GN=MAP3K13 PE=2 SV=1 133 284 2.0E-10
sp|Q16816|PHKG1_HUMAN Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Homo sapiens GN=PHKG1 PE=2 SV=3 100 298 2.0E-10
sp|Q99683|M3K5_HUMAN Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens GN=MAP3K5 PE=1 SV=1 58 280 2.0E-10
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 52 293 2.0E-10
sp|Q9DB30|PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus GN=Phkg2 PE=2 SV=2 84 284 2.0E-10
sp|O08605|MKNK1_MOUSE MAP kinase-interacting serine/threonine-protein kinase 1 OS=Mus musculus GN=Mknk1 PE=1 SV=2 100 275 2.0E-10
sp|O35099|M3K5_MOUSE Mitogen-activated protein kinase kinase kinase 5 OS=Mus musculus GN=Map3k5 PE=1 SV=3 58 280 2.0E-10
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 47 275 3.0E-10
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 47 275 3.0E-10
sp|Q60700|M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus GN=Map3k12 PE=1 SV=1 52 284 3.0E-10
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 44 310 3.0E-10
sp|Q9GN62|PAR4_CAEEL Serine/threonine-protein kinase par-4 OS=Caenorhabditis elegans GN=par-4 PE=1 SV=2 53 277 3.0E-10
sp|Q54B33|PAKE_DICDI Serine/threonine-protein kinase pakE OS=Dictyostelium discoideum GN=pakE PE=3 SV=1 58 268 3.0E-10
sp|O14578|CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens GN=CIT PE=1 SV=2 19 298 3.0E-10
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 44 310 3.0E-10
sp|P38991|IPL1_YEAST Spindle assembly checkpoint kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IPL1 PE=1 SV=1 80 278 3.0E-10
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 54 310 3.0E-10
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 44 310 3.0E-10
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 94 289 3.0E-10
sp|Q54R58|YTYK2_DICDI Probable tyrosine-protein kinase DDB_G0283397 OS=Dictyostelium discoideum GN=DDB_G0283397 PE=3 SV=1 44 275 3.0E-10
sp|Q6GPN6|SGK1A_XENLA Serine/threonine-protein kinase Sgk1-A OS=Xenopus laevis GN=sgk1-a PE=2 SV=1 56 275 3.0E-10
sp|Q6K5F8|CDKG1_ORYSJ Cyclin-dependent kinase G-1 OS=Oryza sativa subsp. japonica GN=CDKG-1 PE=2 SV=1 58 289 3.0E-10
sp|Q621J7|ZYG1_CAEBR Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis briggsae GN=zyg-1 PE=3 SV=1 58 274 3.0E-10
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 58 278 3.0E-10
sp|Q4G050|MKNK1_RAT MAP kinase-interacting serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mknk1 PE=2 SV=1 100 275 3.0E-10
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 79 284 3.0E-10
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 54 292 3.0E-10
sp|A2X6X1|CDKG1_ORYSI Cyclin-dependent kinase G-1 OS=Oryza sativa subsp. indica GN=CDKG-1 PE=3 SV=1 58 289 3.0E-10
sp|Q09136|AAPK1_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragments) OS=Sus scrofa GN=PRKAA1 PE=1 SV=2 98 310 3.0E-10
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 86 275 4.0E-10
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 43 283 4.0E-10
sp|A7KAL2|ATG1_PENRW Serine/threonine-protein kinase atg1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg1 PE=3 SV=1 58 284 4.0E-10
sp|Q55GG4|Y9847_DICDI Probable serine/threonine-protein kinase DDB_G0267686 OS=Dictyostelium discoideum GN=DDB_G0267686 PE=3 SV=1 47 277 4.0E-10
sp|Q7SY24|KPCB_DANRE Protein kinase C beta type OS=Danio rerio GN=prkcbb PE=2 SV=1 58 291 4.0E-10
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 54 310 4.0E-10
sp|Q63796|M3K12_RAT Mitogen-activated protein kinase kinase kinase 12 OS=Rattus norvegicus GN=Map3k12 PE=1 SV=1 52 284 4.0E-10
sp|Q03428|NRKB_TRYBB Putative serine/threonine-protein kinase B OS=Trypanosoma brucei brucei GN=NRKB PE=2 SV=2 110 275 4.0E-10
sp|P41808|SMK1_YEAST Sporulation-specific mitogen-activated protein kinase SMK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMK1 PE=1 SV=1 23 265 4.0E-10
sp|P68403|KPCB_RAT Protein kinase C beta type OS=Rattus norvegicus GN=Prkcb PE=1 SV=3 58 291 4.0E-10
sp|P68404|KPCB_MOUSE Protein kinase C beta type OS=Mus musculus GN=Prkcb PE=1 SV=4 58 291 4.0E-10
sp|P05126|KPCB_BOVIN Protein kinase C beta type OS=Bos taurus GN=PRKCB PE=2 SV=4 58 291 4.0E-10
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 54 298 4.0E-10
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 54 310 4.0E-10
sp|Q9R0T8|IKKE_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Mus musculus GN=Ikbke PE=1 SV=2 100 275 4.0E-10
sp|Q8BPM2|M4K5_MOUSE Mitogen-activated protein kinase kinase kinase kinase 5 OS=Mus musculus GN=Map4k5 PE=1 SV=2 75 268 4.0E-10
sp|Q5R7A7|SGK3_PONAB Serine/threonine-protein kinase Sgk3 OS=Pongo abelii GN=SGK3 PE=2 SV=1 56 275 4.0E-10
sp|Q96BR1|SGK3_HUMAN Serine/threonine-protein kinase Sgk3 OS=Homo sapiens GN=SGK3 PE=1 SV=1 56 275 4.0E-10
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 58 276 4.0E-10
sp|Q0CLX3|ATG1_ASPTN Serine/threonine-protein kinase atg1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg1 PE=3 SV=1 96 284 4.0E-10
sp|Q3UGM2|NEK10_MOUSE Serine/threonine-protein kinase Nek10 OS=Mus musculus GN=Nek10 PE=2 SV=2 47 315 4.0E-10
sp|A2AAJ9|OBSCN_MOUSE Obscurin OS=Mus musculus GN=Obscn PE=1 SV=2 111 316 4.0E-10
sp|O96013|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 OS=Homo sapiens GN=PAK4 PE=1 SV=1 14 275 4.0E-10
sp|P05772|KPCB_RABIT Protein kinase C beta type OS=Oryctolagus cuniculus GN=PRKCB PE=2 SV=3 58 291 4.0E-10
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 50 275 5.0E-10
sp|Q54DC8|Y2350_DICDI Probable serine/threonine-protein kinase DDB_G0292350 OS=Dictyostelium discoideum GN=DDB_G0292350 PE=3 SV=1 109 284 5.0E-10
sp|Q9Y4K4|M4K5_HUMAN Mitogen-activated protein kinase kinase kinase kinase 5 OS=Homo sapiens GN=MAP4K5 PE=1 SV=1 75 268 5.0E-10
sp|Q9SLI2|NEK1_ARATH Serine/threonine-protein kinase Nek1 OS=Arabidopsis thaliana GN=NEK1 PE=2 SV=2 82 317 5.0E-10
sp|Q9SI06|Y5573_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g04300 OS=Arabidopsis thaliana GN=At2g04300 PE=3 SV=2 54 268 5.0E-10
sp|A2AQW0|M3K15_MOUSE Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus GN=Map3k15 PE=1 SV=1 58 280 5.0E-10
sp|P29294|MYLK_RABIT Myosin light chain kinase, smooth muscle OS=Oryctolagus cuniculus GN=MYLK PE=1 SV=2 96 323 5.0E-10
sp|Q5AP97|SWE1_CANAL Mitosis inhibitor protein kinase SWE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWE1 PE=1 SV=1 56 269 5.0E-10
sp|P05771|KPCB_HUMAN Protein kinase C beta type OS=Homo sapiens GN=PRKCB PE=1 SV=4 58 291 5.0E-10
sp|Q96QS6|KPSH2_HUMAN Serine/threonine-protein kinase H2 OS=Homo sapiens GN=PSKH2 PE=2 SV=1 99 307 5.0E-10
sp|P83104|M3K7L_DROME Putative mitogen-activated protein kinase kinase kinase 7-like OS=Drosophila melanogaster GN=Takl1 PE=2 SV=1 128 286 5.0E-10
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 12 275 6.0E-10
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 33 293 6.0E-10
sp|Q9VKN7|AURKB_DROME Aurora kinase B OS=Drosophila melanogaster GN=ial PE=1 SV=1 57 276 6.0E-10
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 58 300 6.0E-10
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 86 275 8.0E-10
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 86 275 9.0E-10
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 86 275 1.0E-09
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 46 279 2.0E-09
sp|Q696W0|SPEG_DANRE Striated muscle preferentially expressed protein kinase OS=Danio rerio GN=speg PE=2 SV=1 131 316 2.0E-09
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 54 303 4.0E-09
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 54 310 5.0E-09
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 53 275 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2432
MASHAQQQQHMAPRSAQRQPASAPQQRLPHAPSAPAGTFSPGTKIQVGSHRVVIQKYLSEGGFAIVYLVKMPQPV
DGTDLAVLKRVAVPDKDSLRNMRTEVETMKRLKGHHPIVTYIDSHASEMRGGGYEVFLLMEYCNGGGLIDFMNTR
LQHRLTEPEILSIFADIAEGVACMHYLKPPLLHRDIKVENVLITSRASSKRFKLCDFGSAAPPRPAPTTVVECRL
MDEDVQKHTTLQYRSPEMIDVYRKQPLNEKADIWALGVLLYKLCYYTTPFEEQGQLAILNASFRYPDYPVFSDPS
MLRESIEARPNIYQVLKEACSMQGRQIPIKDIYTGRPHTADRNSKIPADPKAQPKVGAVYSAPVREKKQQIPEVA
PMRRGDPFTALDSKDGSRLEADELSSRFPTLDQFSLLHDKGTKFDFDSTVSPPTEAHVSVAERRAAAEASNSPRK
TLAVSDRAAGSVRSRAFGKPTAEHLDLSLTRLIYDGHLRPPDRPLMKPGQLRPRRRAPKRRKGHGHKVASSIRAL
QRLSAKENLPKRGLVRDAHCLVDSKTQNSAASDLIDINGADSEPVEKSNASRSVNATPPSASKKKIGGKFEDTFK
RFEGNSRPDSAPVRNDDDDLNDEQATPEMRREMERRQLEEEEQRVAAAQAEYKKRLAGEGNPGPRKGGVVARSAA
IQNRVQSLLEEEQRPSQVQRTAEGYGKYTDAAKPTKDKALPTLPDGLKPRTNVEPSSTSASLGALATKPTGGKPA
APKKPIHLNKTRNEVRPPSPAKRSRPEVLMAVDLPGQPVLEMSAKEKEDYVEDFAKRFPSLNTVELEAMAAAQRR
*
Coding >Ophun1|2432
ATGGCCTCGCACGCGCAACAGCAGCAACACATGGCGCCGCGCTCGGCCCAGAGGCAGCCGGCTTCCGCTCCCCAG
CAGCGTCTGCCGCATGCTCCGTCTGCTCCGGCCGGCACCTTTTCGCCCGGCACCAAGATCCAGGTCGGCAGCCAT
CGGGTCGTGATCCAAAAGTACCTCTCCGAGGGTGGCTTCGCAATTGTATATCTCGTCAAGATGCCTCAGCCTGTC
GACGGCACCGACCTCGCCGTCCTTAAGCGCGTCGCCGTTCCGGACAAGGACTCTCTGCGCAATATGCGTACCGAG
GTCGAGACTATGAAGCGCCTCAAGGGCCACCATCCAATCGTCACCTACATCGACTCTCACGCTTCCGAGATGCGT
GGCGGCGGCTACGAAGTTTTCCTCCTCATGGAGTACTGCAACGGCGGCGGCCTCATCGACTTTATGAACACTCGG
CTACAGCACCGCCTGACGGAGCCCGAGATCCTGTCCATCTTCGCTGACATCGCCGAGGGCGTGGCTTGTATGCAC
TATCTGAAGCCGCCTTTACTGCACAGGGATATCAAGGTCGAAAACGTCCTCATCACCTCCCGCGCCTCCTCCAAG
CGTTTCAAGCTCTGCGACTTTGGTTCTGCCGCTCCGCCGCGTCCGGCACCGACAACCGTCGTCGAGTGCCGCTTG
ATGGATGAGGACGTTCAGAAGCACACGACTCTGCAGTACAGGAGTCCAGAGATGATTGACGTATACAGGAAGCAG
CCTCTCAACGAAAAGGCCGACATTTGGGCTCTCGGCGTTTTGCTCTACAAGCTTTGTTACTACACGACGCCTTTT
GAGGAACAGGGGCAGCTAGCCATCCTAAACGCCAGCTTCCGCTATCCCGACTACCCCGTATTTTCTGACCCCTCC
ATGTTGAGGGAAAGCATCGAGGCTCGGCCAAACATATATCAGGTTCTCAAAGAAGCCTGCTCTATGCAGGGAAGA
CAAATACCCATAAAAGACATCTATACTGGCAGACCGCACACCGCAGACCGGAACAGCAAAATACCTGCCGACCCC
AAGGCGCAGCCAAAGGTCGGCGCTGTCTACTCGGCACCTGTACGGGAGAAGAAGCAGCAGATTCCTGAAGTCGCA
CCGATGCGGAGAGGAGACCCCTTTACCGCTTTGGATTCCAAGGATGGCTCGCGGCTTGAGGCAGACGAGCTGTCT
TCTCGCTTTCCTACCCTCGACCAATTCTCGTTGCTGCACGACAAGGGAACCAAGTTTGACTTTGACTCTACTGTA
TCGCCGCCGACGGAGGCTCACGTTTCGGTAGCGGAGAGGCGAGCTGCTGCCGAAGCATCCAACTCACCTCGGAAG
ACTTTGGCAGTGTCGGATCGCGCCGCTGGCAGCGTGAGGTCCAGGGCATTCGGCAAGCCGACAGCGGAGCACCTC
GATCTCAGTCTCACTCGACTCATCTACGACGGCCATCTCCGCCCCCCGGACCGTCCCTTGATGAAGCCCGGCCAG
CTCCGCCCACGGCGTCGCGCGCCGAAGCGCCGAAAAGGCCACGGCCACAAAGTAGCCTCCTCGATTCGAGCTCTG
CAGCGTTTGTCCGCGAAAGAGAATCTCCCCAAGCGCGGACTGGTTCGGGACGCCCATTGTCTCGTGGATTCCAAG
ACTCAAAACTCGGCCGCCTCGGATCTGATAGACATCAACGGTGCTGATTCGGAACCTGTGGAGAAGTCAAATGCC
TCTAGATCGGTCAACGCGACGCCGCCGTCTGCATCGAAGAAGAAGATCGGTGGCAAGTTTGAGGATACGTTCAAG
CGGTTCGAGGGCAATAGCCGTCCCGACTCGGCGCCAGTCCGCAACGATGATGACGATCTAAATGACGAGCAGGCA
ACCCCGGAAATGAGGCGCGAGATGGAGCGTCGTCAACTGGAGGAGGAGGAACAGCGAGTGGCGGCGGCACAAGCC
GAGTACAAGAAGCGACTGGCCGGCGAGGGCAACCCGGGACCGAGAAAAGGGGGCGTCGTCGCGAGGTCGGCCGCT
ATCCAGAATCGGGTCCAGAGCTTGTTGGAAGAAGAGCAGCGGCCCTCGCAGGTGCAAAGAACGGCCGAGGGCTAC
GGAAAGTACACGGACGCCGCCAAGCCAACCAAGGACAAGGCCCTGCCCACGCTGCCGGACGGGCTCAAGCCCAGG
ACCAATGTCGAGCCGTCATCCACATCAGCATCCTTGGGAGCGTTGGCCACCAAGCCGACAGGAGGCAAGCCAGCG
GCGCCCAAGAAGCCGATTCATCTGAATAAGACGCGCAACGAGGTGCGGCCGCCATCGCCGGCCAAGAGAAGTCGA
CCGGAAGTCCTGATGGCGGTGGATCTGCCGGGTCAGCCCGTGCTGGAAATGTCGGCCAAGGAGAAGGAGGACTAC
GTTGAGGATTTCGCCAAGCGGTTCCCCAGCCTCAACACGGTAGAGCTGGAGGCAATGGCGGCTGCGCAGCGGCGG
TGA
Transcript >Ophun1|2432
ATGGCCTCGCACGCGCAACAGCAGCAACACATGGCGCCGCGCTCGGCCCAGAGGCAGCCGGCTTCCGCTCCCCAG
CAGCGTCTGCCGCATGCTCCGTCTGCTCCGGCCGGCACCTTTTCGCCCGGCACCAAGATCCAGGTCGGCAGCCAT
CGGGTCGTGATCCAAAAGTACCTCTCCGAGGGTGGCTTCGCAATTGTATATCTCGTCAAGATGCCTCAGCCTGTC
GACGGCACCGACCTCGCCGTCCTTAAGCGCGTCGCCGTTCCGGACAAGGACTCTCTGCGCAATATGCGTACCGAG
GTCGAGACTATGAAGCGCCTCAAGGGCCACCATCCAATCGTCACCTACATCGACTCTCACGCTTCCGAGATGCGT
GGCGGCGGCTACGAAGTTTTCCTCCTCATGGAGTACTGCAACGGCGGCGGCCTCATCGACTTTATGAACACTCGG
CTACAGCACCGCCTGACGGAGCCCGAGATCCTGTCCATCTTCGCTGACATCGCCGAGGGCGTGGCTTGTATGCAC
TATCTGAAGCCGCCTTTACTGCACAGGGATATCAAGGTCGAAAACGTCCTCATCACCTCCCGCGCCTCCTCCAAG
CGTTTCAAGCTCTGCGACTTTGGTTCTGCCGCTCCGCCGCGTCCGGCACCGACAACCGTCGTCGAGTGCCGCTTG
ATGGATGAGGACGTTCAGAAGCACACGACTCTGCAGTACAGGAGTCCAGAGATGATTGACGTATACAGGAAGCAG
CCTCTCAACGAAAAGGCCGACATTTGGGCTCTCGGCGTTTTGCTCTACAAGCTTTGTTACTACACGACGCCTTTT
GAGGAACAGGGGCAGCTAGCCATCCTAAACGCCAGCTTCCGCTATCCCGACTACCCCGTATTTTCTGACCCCTCC
ATGTTGAGGGAAAGCATCGAGGCTCGGCCAAACATATATCAGGTTCTCAAAGAAGCCTGCTCTATGCAGGGAAGA
CAAATACCCATAAAAGACATCTATACTGGCAGACCGCACACCGCAGACCGGAACAGCAAAATACCTGCCGACCCC
AAGGCGCAGCCAAAGGTCGGCGCTGTCTACTCGGCACCTGTACGGGAGAAGAAGCAGCAGATTCCTGAAGTCGCA
CCGATGCGGAGAGGAGACCCCTTTACCGCTTTGGATTCCAAGGATGGCTCGCGGCTTGAGGCAGACGAGCTGTCT
TCTCGCTTTCCTACCCTCGACCAATTCTCGTTGCTGCACGACAAGGGAACCAAGTTTGACTTTGACTCTACTGTA
TCGCCGCCGACGGAGGCTCACGTTTCGGTAGCGGAGAGGCGAGCTGCTGCCGAAGCATCCAACTCACCTCGGAAG
ACTTTGGCAGTGTCGGATCGCGCCGCTGGCAGCGTGAGGTCCAGGGCATTCGGCAAGCCGACAGCGGAGCACCTC
GATCTCAGTCTCACTCGACTCATCTACGACGGCCATCTCCGCCCCCCGGACCGTCCCTTGATGAAGCCCGGCCAG
CTCCGCCCACGGCGTCGCGCGCCGAAGCGCCGAAAAGGCCACGGCCACAAAGTAGCCTCCTCGATTCGAGCTCTG
CAGCGTTTGTCCGCGAAAGAGAATCTCCCCAAGCGCGGACTGGTTCGGGACGCCCATTGTCTCGTGGATTCCAAG
ACTCAAAACTCGGCCGCCTCGGATCTGATAGACATCAACGGTGCTGATTCGGAACCTGTGGAGAAGTCAAATGCC
TCTAGATCGGTCAACGCGACGCCGCCGTCTGCATCGAAGAAGAAGATCGGTGGCAAGTTTGAGGATACGTTCAAG
CGGTTCGAGGGCAATAGCCGTCCCGACTCGGCGCCAGTCCGCAACGATGATGACGATCTAAATGACGAGCAGGCA
ACCCCGGAAATGAGGCGCGAGATGGAGCGTCGTCAACTGGAGGAGGAGGAACAGCGAGTGGCGGCGGCACAAGCC
GAGTACAAGAAGCGACTGGCCGGCGAGGGCAACCCGGGACCGAGAAAAGGGGGCGTCGTCGCGAGGTCGGCCGCT
ATCCAGAATCGGGTCCAGAGCTTGTTGGAAGAAGAGCAGCGGCCCTCGCAGGTGCAAAGAACGGCCGAGGGCTAC
GGAAAGTACACGGACGCCGCCAAGCCAACCAAGGACAAGGCCCTGCCCACGCTGCCGGACGGGCTCAAGCCCAGG
ACCAATGTCGAGCCGTCATCCACATCAGCATCCTTGGGAGCGTTGGCCACCAAGCCGACAGGAGGCAAGCCAGCG
GCGCCCAAGAAGCCGATTCATCTGAATAAGACGCGCAACGAGGTGCGGCCGCCATCGCCGGCCAAGAGAAGTCGA
CCGGAAGTCCTGATGGCGGTGGATCTGCCGGGTCAGCCCGTGCTGGAAATGTCGGCCAAGGAGAAGGAGGACTAC
GTTGAGGATTTCGCCAAGCGGTTCCCCAGCCTCAACACGGTAGAGCTGGAGGCAATGGCGGCTGCGCAGCGGCGG
TGA
Gene >Ophun1|2432
ATGGCCTCGCACGCGCAACAGCAGCAACACATGGCGCCGCGCTCGGCCCAGAGGCAGCCGGCTTCCGCTCCCCAG
CAGCGTCTGCCGCATGCTCCGTCTGCTCCGGCCGGCACCTTTTCGCCCGGCACCAAGATCCAGGTCGGCAGCCAT
CGGGTCGTGATCCAAAAGTACCTCTCCGAGGGTGGCTTCGCAATTGTATATCTCGTCAAGATGCCTCAGCCTGTC
GACGGCACCGACCTCGCCGTCCTTAAGCGCGTCGCCGTTCCGGACAAGGACTCTCTGCGCAATATGCGTACCGAG
GTCGAGACTATGAAGCGCCTCAAGGGCCACCATCCAATCGTCACCTACATCGACTCTCACGCTTCCGAGATGCGT
GGCGGCGGCTACGAAGTTTTCCTCCTCATGGAGTACTGCAACGGCGGCGGCCTCATCGACTTTATGAACACTCGG
CTACAGCACCGCCTGACGGAGCCCGAGATCCTGTCCATCTTCGCTGACATCGCCGAGGGCGTGGCTTGTATGCAC
TATCTGAAGCCGCCTTTACTGCACAGGGATATCAAGGTCGAAAACGTCCTCATCACCTCCCGCGCCTCCTCCAAG
CGTTTCAAGCTCTGCGACTTTGGTTCTGCCGCTCCGCCGCGTCCGGCACCGACAACCGTCGTCGAGTGCCGCTTG
ATGGATGAGGACGTTCAGAAGCACACGACTCTGCAGTACAGGAGTCCAGAGATGATTGACGTATACAGGAAGCAG
CCTCTCAACGAAAAGGCCGACATTTGGGCTCTCGGCGTTTTGCTCTACAAGCTTTGTTACTACACGACGCCTTTT
GAGGAACAGGGGCAGCTAGCCATCCTAAACGCCAGCTTCCGCTATCCCGACTACCCCGTATTTTCTGACCGTATA
AAGAAACTGATAGGTATGAGCCATGGTGTTTTTGTGAACCGTTCTCGCTAACGCACCCGAAGCCTCCATGTTGAG
GGAAAGCATCGAGGCTCGGCCAAACATATATCAGGTTCTCAAAGAAGCCTGCTCTATGCAGGGAAGACAAATACC
CATAAAAGACGTGAGACTTTCCCTTCCGCCTTTGACAGTCGGTGCAGTTGCTGACAGCCGCCCAGATCTATACTG
GCAGACCGCACACCGCAGACCGGAACAGCAAAATACCTGCCGACCCCAAGGCGCAGCCAAAGGTCGGCGCTGTCT
ACTCGGCACCTGTACGGGAGAAGAAGCAGCAGATTCCTGAAGTCGCACCGATGCGGAGAGGTAGGCCTGCTCCGT
CCCAAGCAGCTTCAGACACACGTAGCTCGCCGCCAAAGAAGGTGACCGAAGGAGACCCCTTTACCGCTTTGGATT
CCAAGGATGGCTCGCGGCTTGAGGCAGACGAGCTGTCTTCTCGCTTTCCTACCCTCGACCAATTCTCGTTGCTGC
ACGACAAGGGAACCAAGTTTGACTTTGACTCTACTGTATCGCCGCCGACGGAGGCTCACGTTTCGGTAGCGGAGA
GGCGAGCTGCTGCCGAAGCATCCAACTCACCTCGGAAGACTTTGGCAGTGTCGGATCGCGCCGCTGGCAGCGTGA
GGTCCAGGTCAGAACAGCCCAGAGGCTCTGTCAATGCGAATTATGTGTCGACTGGCACGATGACAACTCAAGAAT
CGGTCGAGTCGCTTTCCAGGCGAGCTGATCAGGGCATTCGGCAAGCCGACAGCGGAGCACCTCGATCTCAGTCTC
ACTCGACTCATCTACGACGGCCATCTCCGCCCCCCGGACCGTCCCTTGATGAAGCCCGGCCAGCTCCGCCCACGG
CGTCGCGCGCCGAAGCGCCGAAAAGGCCACGGCCACAAAGTAGCCTCCTCGATTCGAGCTCTGCAGCGTTTGTCC
GCGAAAGAGAATCTCCCCAAGCGCGGACTGGTTCGGGACGCCCATTGTCTCGTGGGTCACAGCTCAAACCGTCTT
CAAGTCCCAGGCCTACGGCACGTCTAGATTCCAAGACTCAAAACTCGGCCGCCTCGGATCTGATAGACATCAACG
GTGCTGATTCGGAACCTGTGGAGAAGTCAAATGCCTCTAGATCGGTCAACGCGACGCCGCCGTCTGCATCGAAGA
AGAAGATCGGTGGCAAGTTTGAGGATACGTTCAAGCGGTTCGAGGGCAATAGCCGTCCCGACTCGGCGCCAGTCC
GCAACGATGATGACGATCTAAATGACGAGCAGGCAACCCCGGAAATGAGGCGCGAGATGGAGCGTCGTCAACTGG
AGGAGGAGGAACAGCGAGTGGCGGCGGCACAAGCCGAGTACAAGAAGCGACTGGCCGGCGAGGGCAACCCGGGAC
CGAGAAAAGGGGGCGTCGTCGCGAGGTCGGCCGCTATCCAGAATCGGGTCCAGAGCTTGTTGGAAGAAGAGCAGC
GGCCCTCGCAGGTGCAAAGAACGGCCGAGGGCTACGGAAAGTACACGGACGCCGCCAAGCCAACCAAGGACAAGG
CCCTGCCCACGCTGCCGGACGGGCTCAAGCCCAGGACCAATGTCGAGCCGTCATCCACATCAGCATCCTTGGGAG
CGTTGGCCACCAAGCCGACAGGAGGCAAGCCAGCGGCGCCCAAGAAGCCGATTCATCTGAATAAGACGCGCAACG
AGGTGCGGCCGCCATCGCCGGCCAAGAGAAGTCGACCGGAAGTCCTGATGGCGGTGGATCTGCCGGGTCAGCCCG
TGCTGGAAATGTCGGCCAAGGAGAAGGAGGACTACGTTGAGGATTTCGCCAAGCGGTTCCCCAGCCTCAACACGG
TAGAGCTGGAGGCAATGGCGGCTGCGCAGCGGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail