Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2429
Gene name
LocationContig_22:44641..46637
Strand-
Gene length (bp)1996
Transcript length (bp)1941
Coding sequence length (bp)1941
Protein length (aa) 647

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14479 HeLo Prion-inhibition and propagation 3.0E-36 8 220

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2649
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2327
Ophiocordyceps australis map64 (Brazil) OphauB2|569
Ophiocordyceps camponoti-floridani Ophcf2|03434
Ophiocordyceps camponoti-rufipedis Ophun1|2429 (this protein)
Ophiocordyceps kimflemingae Ophio5|124
Ophiocordyceps subramaniannii Hirsu2|4067

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2429
MDPISISGLALGVASLGLQPGNGQPAIQLLVTALGYDDECRYLNLRLRMEQQRLYAWSETSGLLDLDADNQDRVL
NSNLFSLHRQTILDLLVQVRCLFDDFTAHQRRHENLRPVRDDDDVLETPDRDAKRANFPMSDRKRDFIRKAMAGL
RGKSQDAWLRLRWTSIDKEAFERLLAKFAALNDNMTDLLDHTLQLEIRQTVQHTNRAVLLLNRKITDLGHLVLAL
RSQLDAGAATSTVSPASTVKREAAVNALLQLTELAKFKAFNETINPKAGVATRVDAVTAEFLQLAEPDLACHLRL
DRRRIELDPAVDDADETPRCEAVLTTVIGGKETKKRVWIEWKDYDDAGTHRDSLSKADIVDRVRKLACLLHRSPK
PDAFRTPHCLGFFDKADDGVADADVDVLDRRLGLVFERPSGAGLHADLPPVSLHELLRDGGGRKPRVTERVRLAH
ALANCVLYLHAVNWLHKGLRSHNVLFFRPRAGHVDLTQPYLSGFDFSRPGGSDEMTDAPGDDAEHDLYRHPLTQS
NRRGERERSKKSFDIYSLGVILVELAHWKTVDEVLAVDLRRARGNPEVARRVRERLLDDDSVAGVGAETGLRFEQ
ATRTCLEGGAELGLQAGDDETRDEVAERLSTRYYEGVVKRLGEIVV*
Coding >Ophun1|2429
ATGGACCCCATCTCCATCAGTGGGCTCGCTCTAGGCGTCGCCTCGCTGGGCCTTCAGCCCGGTAACGGCCAGCCA
GCCATCCAGCTCCTCGTCACCGCCCTCGGCTACGACGATGAGTGCAGATATCTCAATCTGCGCCTGCGCATGGAG
CAGCAGCGCCTGTACGCCTGGAGCGAGACGTCGGGCCTGCTCGATCTCGATGCCGATAACCAGGATCGCGTCCTG
AACTCGAACCTCTTCAGTCTGCATCGCCAGACCATTCTCGACCTGCTGGTTCAAGTCCGCTGCCTCTTCGACGAC
TTCACCGCCCACCAGCGTAGGCACGAGAACCTTCGCCCCGTCCGCGATGATGACGACGTGCTCGAAACCCCCGAT
CGCGACGCCAAGCGTGCCAATTTCCCCATGTCGGATAGGAAACGCGACTTCATCCGCAAGGCCATGGCTGGCCTG
CGCGGTAAGTCGCAAGATGCCTGGCTGCGACTGCGCTGGACATCCATCGACAAGGAGGCCTTTGAGAGGCTGCTC
GCCAAGTTTGCTGCCCTCAACGACAACATGACGGATCTGCTCGATCACACGCTCCAGCTTGAGATTCGTCAGACG
GTCCAACATACCAATCGCGCCGTCCTCCTCCTCAATCGCAAGATCACCGACCTCGGTCACCTCGTTCTCGCCCTC
AGGTCACAGCTTGACGCCGGCGCAGCAACCTCGACCGTCTCGCCCGCCTCCACAGTCAAGCGCGAGGCCGCCGTC
AATGCGCTATTGCAACTCACCGAGCTGGCCAAGTTCAAGGCCTTTAACGAAACCATCAATCCCAAGGCCGGTGTT
GCGACCCGCGTTGATGCGGTCACGGCCGAGTTCCTGCAGCTGGCCGAGCCGGACCTGGCGTGTCATCTCCGGCTG
GACCGCCGCCGCATTGAGCTCGACCCGGCCGTCGATGACGCCGATGAGACGCCCCGGTGCGAGGCCGTGTTGACG
ACGGTCATCGGAGGGAAGGAGACGAAGAAGCGGGTCTGGATCGAATGGAAGGACTACGACGACGCCGGCACCCAT
CGGGATTCGCTGTCCAAGGCAGACATTGTCGACCGCGTGCGCAAGCTGGCGTGTCTGCTACACCGCAGCCCCAAG
CCCGACGCCTTCCGGACGCCGCATTGCCTGGGCTTCTTCGACAAGGCCGACGACGGCGTGGCCGATGCCGACGTC
GACGTGCTCGACCGGCGGCTTGGCCTCGTCTTTGAGCGTCCCAGCGGTGCCGGCCTGCACGCCGACCTGCCGCCC
GTGTCGTTGCACGAGCTCCTACGCGATGGTGGCGGCCGCAAGCCGCGGGTTACGGAGCGTGTCAGGCTCGCACAT
GCCCTGGCCAACTGCGTGCTCTACCTGCACGCCGTCAACTGGCTGCACAAGGGTCTACGCAGCCACAACGTGCTC
TTCTTCCGACCGCGCGCCGGTCACGTCGACTTGACGCAGCCCTATCTCTCGGGCTTTGACTTTTCGCGGCCGGGC
GGGTCGGACGAGATGACGGACGCTCCGGGAGATGACGCCGAGCACGACTTATACCGGCACCCGCTGACGCAGTCG
AACCGGCGCGGAGAGCGCGAGCGGTCCAAGAAGAGCTTCGACATATATAGCTTGGGTGTCATCTTGGTGGAGCTG
GCCCACTGGAAGACGGTAGACGAGGTGCTGGCCGTCGACTTGCGGCGCGCAAGGGGCAATCCAGAGGTGGCCAGG
CGTGTGAGGGAGCGGCTACTGGACGACGACAGTGTCGCCGGCGTCGGAGCCGAGACGGGGCTGAGGTTTGAACAG
GCGACGAGGACCTGTCTGGAGGGAGGGGCCGAGTTGGGCCTGCAGGCGGGCGACGACGAGACGAGGGACGAGGTG
GCGGAGAGGCTCTCGACGAGATACTACGAGGGTGTGGTCAAGAGGTTGGGGGAGATTGTCGTCTAG
Transcript >Ophun1|2429
ATGGACCCCATCTCCATCAGTGGGCTCGCTCTAGGCGTCGCCTCGCTGGGCCTTCAGCCCGGTAACGGCCAGCCA
GCCATCCAGCTCCTCGTCACCGCCCTCGGCTACGACGATGAGTGCAGATATCTCAATCTGCGCCTGCGCATGGAG
CAGCAGCGCCTGTACGCCTGGAGCGAGACGTCGGGCCTGCTCGATCTCGATGCCGATAACCAGGATCGCGTCCTG
AACTCGAACCTCTTCAGTCTGCATCGCCAGACCATTCTCGACCTGCTGGTTCAAGTCCGCTGCCTCTTCGACGAC
TTCACCGCCCACCAGCGTAGGCACGAGAACCTTCGCCCCGTCCGCGATGATGACGACGTGCTCGAAACCCCCGAT
CGCGACGCCAAGCGTGCCAATTTCCCCATGTCGGATAGGAAACGCGACTTCATCCGCAAGGCCATGGCTGGCCTG
CGCGGTAAGTCGCAAGATGCCTGGCTGCGACTGCGCTGGACATCCATCGACAAGGAGGCCTTTGAGAGGCTGCTC
GCCAAGTTTGCTGCCCTCAACGACAACATGACGGATCTGCTCGATCACACGCTCCAGCTTGAGATTCGTCAGACG
GTCCAACATACCAATCGCGCCGTCCTCCTCCTCAATCGCAAGATCACCGACCTCGGTCACCTCGTTCTCGCCCTC
AGGTCACAGCTTGACGCCGGCGCAGCAACCTCGACCGTCTCGCCCGCCTCCACAGTCAAGCGCGAGGCCGCCGTC
AATGCGCTATTGCAACTCACCGAGCTGGCCAAGTTCAAGGCCTTTAACGAAACCATCAATCCCAAGGCCGGTGTT
GCGACCCGCGTTGATGCGGTCACGGCCGAGTTCCTGCAGCTGGCCGAGCCGGACCTGGCGTGTCATCTCCGGCTG
GACCGCCGCCGCATTGAGCTCGACCCGGCCGTCGATGACGCCGATGAGACGCCCCGGTGCGAGGCCGTGTTGACG
ACGGTCATCGGAGGGAAGGAGACGAAGAAGCGGGTCTGGATCGAATGGAAGGACTACGACGACGCCGGCACCCAT
CGGGATTCGCTGTCCAAGGCAGACATTGTCGACCGCGTGCGCAAGCTGGCGTGTCTGCTACACCGCAGCCCCAAG
CCCGACGCCTTCCGGACGCCGCATTGCCTGGGCTTCTTCGACAAGGCCGACGACGGCGTGGCCGATGCCGACGTC
GACGTGCTCGACCGGCGGCTTGGCCTCGTCTTTGAGCGTCCCAGCGGTGCCGGCCTGCACGCCGACCTGCCGCCC
GTGTCGTTGCACGAGCTCCTACGCGATGGTGGCGGCCGCAAGCCGCGGGTTACGGAGCGTGTCAGGCTCGCACAT
GCCCTGGCCAACTGCGTGCTCTACCTGCACGCCGTCAACTGGCTGCACAAGGGTCTACGCAGCCACAACGTGCTC
TTCTTCCGACCGCGCGCCGGTCACGTCGACTTGACGCAGCCCTATCTCTCGGGCTTTGACTTTTCGCGGCCGGGC
GGGTCGGACGAGATGACGGACGCTCCGGGAGATGACGCCGAGCACGACTTATACCGGCACCCGCTGACGCAGTCG
AACCGGCGCGGAGAGCGCGAGCGGTCCAAGAAGAGCTTCGACATATATAGCTTGGGTGTCATCTTGGTGGAGCTG
GCCCACTGGAAGACGGTAGACGAGGTGCTGGCCGTCGACTTGCGGCGCGCAAGGGGCAATCCAGAGGTGGCCAGG
CGTGTGAGGGAGCGGCTACTGGACGACGACAGTGTCGCCGGCGTCGGAGCCGAGACGGGGCTGAGGTTTGAACAG
GCGACGAGGACCTGTCTGGAGGGAGGGGCCGAGTTGGGCCTGCAGGCGGGCGACGACGAGACGAGGGACGAGGTG
GCGGAGAGGCTCTCGACGAGATACTACGAGGGTGTGGTCAAGAGGTTGGGGGAGATTGTCGTCTAG
Gene >Ophun1|2429
ATGGACCCCATCTCCATCAGTGGGCTCGCTCTAGGCGTCGCCTCGCTGGGCCTTCAGGTCTATACCGGCTGCATT
CAAGGCACGTACAGCATCGGTCTCGTCCGTCAAGCAGCCCGGTAACGGCCAGCCAGCCATCCAGCTCCTCGTCAC
CGCCCTCGGCTACGACGATGAGTGCAGATATCTCAATCTGCGCCTGCGCATGGAGCAGCAGCGCCTGTACGCCTG
GAGCGAGACGTCGGGCCTGCTCGATCTCGATGCCGATAACCAGGATCGCGTCCTGAACTCGAACCTCTTCAGTCT
GCATCGCCAGACCATTCTCGACCTGCTGGTTCAAGTCCGCTGCCTCTTCGACGACTTCACCGCCCACCAGCGTAG
GCACGAGAACCTTCGCCCCGTCCGCGATGATGACGACGTGCTCGAAACCCCCGATCGCGACGCCAAGCGTGCCAA
TTTCCCCATGTCGGATAGGAAACGCGACTTCATCCGCAAGGCCATGGCTGGCCTGCGCGGTAAGTCGCAAGATGC
CTGGCTGCGACTGCGCTGGACATCCATCGACAAGGAGGCCTTTGAGAGGCTGCTCGCCAAGTTTGCTGCCCTCAA
CGACAACATGACGGATCTGCTCGATCACACGCTCCAGCTTGAGATTCGTCAGACGGTCCAACATACCAATCGCGC
CGTCCTCCTCCTCAATCGCAAGATCACCGACCTCGGTCACCTCGTTCTCGCCCTCAGGTCACAGCTTGACGCCGG
CGCAGCAACCTCGACCGTCTCGCCCGCCTCCACAGTCAAGCGCGAGGCCGCCGTCAATGCGCTATTGCAACTCAC
CGAGCTGGCCAAGTTCAAGGCCTTTAACGAAACCATCAATCCCAAGGCCGGTGTTGCGACCCGCGTTGATGCGGT
CACGGCCGAGTTCCTGCAGCTGGCCGAGCCGGACCTGGCGTGTCATCTCCGGCTGGACCGCCGCCGCATTGAGCT
CGACCCGGCCGTCGATGACGCCGATGAGACGCCCCGGTGCGAGGCCGTGTTGACGACGGTCATCGGAGGGAAGGA
GACGAAGAAGCGGGTCTGGATCGAATGGAAGGACTACGACGACGCCGGCACCCATCGGGATTCGCTGTCCAAGGC
AGACATTGTCGACCGCGTGCGCAAGCTGGCGTGTCTGCTACACCGCAGCCCCAAGCCCGACGCCTTCCGGACGCC
GCATTGCCTGGGCTTCTTCGACAAGGCCGACGACGGCGTGGCCGATGCCGACGTCGACGTGCTCGACCGGCGGCT
TGGCCTCGTCTTTGAGCGTCCCAGCGGTGCCGGCCTGCACGCCGACCTGCCGCCCGTGTCGTTGCACGAGCTCCT
ACGCGATGGTGGCGGCCGCAAGCCGCGGGTTACGGAGCGTGTCAGGCTCGCACATGCCCTGGCCAACTGCGTGCT
CTACCTGCACGCCGTCAACTGGCTGCACAAGGGTCTACGCAGCCACAACGTGCTCTTCTTCCGACCGCGCGCCGG
TCACGTCGACTTGACGCAGCCCTATCTCTCGGGCTTTGACTTTTCGCGGCCGGGCGGGTCGGACGAGATGACGGA
CGCTCCGGGAGATGACGCCGAGCACGACTTATACCGGCACCCGCTGACGCAGTCGAACCGGCGCGGAGAGCGCGA
GCGGTCCAAGAAGAGCTTCGACATATATAGCTTGGGTGTCATCTTGGTGGAGCTGGCCCACTGGAAGACGGTAGA
CGAGGTGCTGGCCGTCGACTTGCGGCGCGCAAGGGGCAATCCAGAGGTGGCCAGGCGTGTGAGGGAGCGGCTACT
GGACGACGACAGTGTCGCCGGCGTCGGAGCCGAGACGGGGCTGAGGTTTGAACAGGCGACGAGGACCTGTCTGGA
GGGAGGGGCCGAGTTGGGCCTGCAGGCGGGCGACGACGAGACGAGGGACGAGGTGGCGGAGAGGCTCTCGACGAG
ATACTACGAGGGTGTGGTCAAGAGGTTGGGGGAGATTGTCGTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail