Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2427
Gene name
LocationContig_22:37808..40816
Strand-
Gene length (bp)3008
Transcript length (bp)2919
Coding sequence length (bp)2919
Protein length (aa) 973

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase 4.0E-13 247 328

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q07830|GPI13_YEAST GPI ethanolamine phosphate transferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI13 PE=1 SV=1 42 945 1.0E-163
sp|O13663|GPI13_SCHPO GPI ethanolamine phosphate transferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi13 PE=3 SV=1 71 919 1.0E-126
sp|Q8TEQ8|PIGO_HUMAN GPI ethanolamine phosphate transferase 3 OS=Homo sapiens GN=PIGO PE=1 SV=3 53 509 9.0E-97
sp|Q74ZS2|GPI13_ASHGO GPI ethanolamine phosphate transferase 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GPI13 PE=3 SV=2 48 489 3.0E-91
sp|Q9JJI6|PIGO_MOUSE GPI ethanolamine phosphate transferase 3 OS=Mus musculus GN=Pigo PE=1 SV=2 53 493 2.0E-89
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q07830|GPI13_YEAST GPI ethanolamine phosphate transferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI13 PE=1 SV=1 42 945 1.0E-163
sp|O13663|GPI13_SCHPO GPI ethanolamine phosphate transferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi13 PE=3 SV=1 71 919 1.0E-126
sp|Q8TEQ8|PIGO_HUMAN GPI ethanolamine phosphate transferase 3 OS=Homo sapiens GN=PIGO PE=1 SV=3 53 509 9.0E-97
sp|Q74ZS2|GPI13_ASHGO GPI ethanolamine phosphate transferase 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GPI13 PE=3 SV=2 48 489 3.0E-91
sp|Q9JJI6|PIGO_MOUSE GPI ethanolamine phosphate transferase 3 OS=Mus musculus GN=Pigo PE=1 SV=2 53 493 2.0E-89
sp|Q6C7Q6|GPI7_YARLI GPI ethanolamine phosphate transferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LAS21 PE=3 SV=1 51 400 4.0E-53
sp|Q6CLN2|GPI7_KLULA GPI ethanolamine phosphate transferase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAS21 PE=3 SV=1 67 400 5.0E-51
sp|Q758B8|GPI7_ASHGO GPI ethanolamine phosphate transferase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LAS21 PE=3 SV=2 60 400 6.0E-48
sp|Q6BZ57|GPI7_DEBHA GPI ethanolamine phosphate transferase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LAS21 PE=3 SV=2 60 400 2.0E-47
sp|Q74ZS2|GPI13_ASHGO GPI ethanolamine phosphate transferase 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GPI13 PE=3 SV=2 619 944 9.0E-47
sp|Q8TGB2|GPI7_CANAL GPI ethanolamine phosphate transferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LAS21 PE=3 SV=2 51 400 4.0E-46
sp|Q4WDM5|GPI7_ASPFU GPI ethanolamine phosphate transferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=las21 PE=2 SV=1 67 407 6.0E-44
sp|P40367|GPI7_YEAST GPI ethanolamine phosphate transferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAS21 PE=1 SV=1 110 400 2.0E-42
sp|Q5H8A4|PIGG_HUMAN GPI ethanolamine phosphate transferase 2 OS=Homo sapiens GN=PIGG PE=1 SV=1 63 395 2.0E-42
sp|Q09782|GPI7_SCHPO GPI ethanolamine phosphate transferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=las21 PE=3 SV=1 62 422 1.0E-41
sp|Q2U9J2|GPI7_ASPOR GPI ethanolamine phosphate transferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=las21 PE=3 SV=2 48 411 1.0E-39
sp|Q6FPB2|GPI7_CANGA GPI ethanolamine phosphate transferase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LAS21 PE=3 SV=1 60 400 4.0E-38
sp|Q9R1S3|PIGN_MOUSE GPI ethanolamine phosphate transferase 1 OS=Mus musculus GN=Pign PE=2 SV=2 276 504 1.0E-07
sp|Q757X5|MCD4_ASHGO GPI ethanolamine phosphate transferase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MCD4 PE=3 SV=2 271 430 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.5

Transmembrane Domains

Domain # Start End Length
1 50 72 22
2 493 512 19
3 555 577 22
4 587 606 19
5 619 641 22
6 646 665 19
7 672 690 18
8 716 738 22
9 747 769 22
10 799 821 22
11 842 864 22
12 879 901 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2427
MPPDQGQSEYRALADQWAAAKAKATTTKPDPKPQGETLNQLRKRAYESRWRWTLAFWIWLLFIHAGAIWLFASGF
LLTRLVLEQKSECGSPPTNSSLAPLDVELGCWHPKKFERAVIIVIDALRYDFTIPTTSDDTRHYHNALPFLHEEA
VAQPRNSFLRPFIADPPTTTLQRLKGLTTGTLPTFVDAGSNFAGTAIDEDNLLMQMRRSGKKIAHLGDDTWWSLF
PGYFEANISRAYDSFNVWDLHTVDNGVIDNIFPLLEKQGGGNGQWDLLIGHCLGVDHAGHRYGPDHPAMEAKLGQ
MDGFVRRVAAAIDDDTLLVVMGDHGMDAKGDHGGESDDEVEAALWMYSKRPAFGRTSPEHAVPPATAKTRPVNQI
DLVPTLALLLGIPIPYNSLGRPIEEAFVSTDGGGGSDWANLAAVSRMSAAGVQRYQESYFAARGVTPDTQPGSPA
DLWERARAETRSDAETYEALVRFQERTLQVCKGLWARFDVPRMVAGVAVAAAGVVLLALYASRGPDDEYLVVDDV
ELDYAERRLELAAFRGEAERHPDQSYHRDLLRGLWDIRFLAVTAAASAAVVFGCRQRSVDGVATVIMALMVATVG
ASLHGAGKTVARLLPRNVWGWLSVFFCVGHSIGFASNSYTVWEDTILLFSIATFGVVAAVASFRIENRADRALAV
YHSVALVVLGRLASYSKLCREEQMPYCTSTYYASAASSTSGPWQLAVPFVVFAVLPSVLASFLRPTRSYEGLAPT
WIGYVFRAGLLMTAIYWVIDAADNGDWLGGRVPEGSVKAAGVYLAQLSLALAVVAGTTAFTWAPPCVSVVPAGPS
RVAILGYGNALGARYLLLPLNVLGACLAVTKPMGGGALALMLWQVLSLAEVVDLIGIRGETTGPVVLAMLGNFYF
FRTGHQAALSSIQWDSAFVALFTIRYPWSPLSVTLNTFAGQILAASIFRRRGGGDDDVCGVATEASHAVPGV*
Coding >Ophun1|2427
ATGCCGCCGGATCAGGGTCAGAGCGAATACCGCGCCTTGGCCGACCAGTGGGCCGCAGCAAAGGCAAAGGCCACC
ACGACGAAGCCAGACCCCAAGCCCCAGGGCGAGACGTTGAATCAGCTTCGGAAACGGGCCTACGAGAGCCGCTGG
AGGTGGACTCTAGCTTTCTGGATCTGGCTGCTTTTTATTCACGCCGGAGCTATCTGGCTCTTTGCCAGCGGCTTC
CTCCTCACCCGTCTGGTCCTCGAGCAAAAATCAGAGTGTGGCTCGCCGCCGACCAACAGCAGTCTGGCCCCTTTG
GACGTCGAGCTCGGCTGCTGGCACCCCAAGAAGTTTGAAAGGGCAGTCATCATTGTCATCGATGCACTTCGCTAC
GACTTTACCATCCCGACCACTTCAGACGACACCCGGCATTACCACAATGCGCTGCCGTTCCTACACGAAGAGGCT
GTTGCGCAGCCGCGGAACTCCTTTTTACGTCCTTTTATTGCGGATCCGCCGACGACGACGCTGCAGCGGCTCAAG
GGCCTGACGACGGGCACGCTGCCTACTTTTGTGGACGCGGGGAGTAACTTTGCTGGCACGGCTATTGATGAGGAT
AATTTGTTGATGCAGATGCGGCGGTCGGGCAAGAAGATTGCTCATCTGGGTGATGATACCTGGTGGTCTCTCTTT
CCGGGCTACTTTGAGGCCAACATCTCGAGGGCCTATGACAGCTTCAACGTCTGGGACCTTCACACGGTCGACAAT
GGCGTCATCGACAACATTTTTCCCTTGCTAGAGAAGCAGGGCGGTGGTAATGGCCAGTGGGATCTGCTCATCGGC
CACTGCCTGGGCGTCGACCATGCCGGCCACCGGTACGGGCCCGATCACCCGGCCATGGAGGCCAAGCTGGGTCAG
ATGGACGGTTTTGTGCGGCGGGTGGCGGCCGCCATTGACGATGATACGCTCCTTGTCGTCATGGGCGATCACGGA
ATGGACGCAAAGGGTGACCATGGCGGCGAGAGCGACGACGAGGTCGAGGCCGCGCTCTGGATGTACTCCAAGAGG
CCAGCCTTTGGCCGCACATCACCGGAGCACGCGGTTCCGCCGGCGACGGCCAAGACGCGTCCCGTCAATCAGATT
GATTTGGTGCCGACGCTGGCCCTGCTGCTCGGCATCCCGATCCCGTATAACAGTCTGGGCCGGCCGATCGAGGAG
GCTTTTGTCTCGACAGATGGCGGAGGCGGTAGCGACTGGGCCAACCTGGCGGCCGTCTCCCGCATGTCGGCCGCC
GGCGTGCAGAGATATCAGGAGTCGTACTTTGCGGCCCGCGGCGTCACGCCCGACACGCAACCGGGGTCGCCCGCC
GATCTGTGGGAACGGGCCCGGGCCGAAACCCGGTCAGACGCCGAAACCTACGAGGCCCTGGTACGCTTTCAGGAG
CGCACTCTGCAGGTCTGCAAGGGGCTGTGGGCGCGCTTCGACGTTCCGCGGATGGTGGCGGGTGTGGCCGTTGCG
GCGGCGGGCGTCGTGTTGCTGGCGCTGTACGCGTCGAGGGGCCCGGATGACGAGTATCTTGTCGTCGACGACGTT
GAGCTCGACTATGCCGAGAGGAGGCTTGAGCTGGCGGCCTTTCGGGGCGAGGCGGAGCGACATCCGGACCAGTCG
TACCACCGAGACCTGCTTCGCGGCTTATGGGATATCCGCTTCCTGGCCGTCACGGCGGCGGCGTCGGCGGCCGTT
GTCTTCGGCTGTCGGCAGCGGTCGGTCGATGGAGTGGCTACGGTCATCATGGCACTGATGGTAGCCACTGTCGGG
GCGTCGTTGCACGGAGCCGGCAAGACGGTGGCCCGACTGTTGCCGCGCAACGTCTGGGGCTGGCTGTCGGTATTC
TTTTGCGTCGGACACTCAATTGGGTTCGCTTCCAACTCGTATACGGTATGGGAGGACACGATCCTGCTCTTCTCC
ATCGCCACGTTTGGCGTCGTCGCGGCCGTGGCCTCATTCCGGATCGAGAACCGGGCGGATCGGGCGTTGGCGGTG
TATCACAGTGTCGCGCTGGTGGTGCTCGGCCGGTTGGCGTCGTACTCGAAGCTCTGTCGCGAGGAGCAGATGCCA
TACTGCACGTCGACGTACTACGCGTCGGCGGCGTCGTCTACGTCTGGACCGTGGCAGCTGGCAGTACCATTTGTC
GTCTTTGCGGTGCTTCCGTCGGTGTTGGCATCGTTTCTTCGGCCGACGAGGTCGTACGAGGGCCTGGCTCCTACT
TGGATCGGCTACGTCTTCCGGGCCGGTCTTCTGATGACGGCCATCTACTGGGTCATCGACGCGGCCGATAACGGC
GACTGGCTCGGCGGACGGGTTCCCGAAGGCTCCGTCAAGGCGGCGGGCGTCTACCTGGCGCAACTGAGCCTTGCG
CTGGCGGTGGTGGCGGGCACGACGGCCTTTACATGGGCTCCTCCGTGTGTCTCCGTCGTGCCAGCCGGTCCGTCG
CGGGTGGCCATCTTGGGCTACGGGAATGCCCTGGGCGCACGCTACCTGCTGCTGCCGCTCAACGTGCTGGGCGCG
TGTCTGGCGGTGACGAAGCCCATGGGCGGCGGAGCGCTGGCTCTGATGCTCTGGCAGGTTCTCTCCCTGGCCGAG
GTTGTGGACCTGATCGGTATCCGGGGCGAGACGACGGGGCCCGTGGTTCTGGCCATGCTGGGGAACTTTTACTTC
TTCCGCACGGGACACCAGGCTGCGCTGTCGAGTATCCAGTGGGACAGCGCCTTTGTCGCCCTCTTCACCATCCGT
TACCCCTGGTCCCCCTTGTCGGTAACACTCAACACGTTTGCCGGCCAGATCCTCGCCGCCTCGATATTTCGCCGT
CGAGGCGGTGGCGACGATGACGTGTGCGGGGTGGCTACGGAGGCATCTCATGCTGTACCGGGTGTTTAG
Transcript >Ophun1|2427
ATGCCGCCGGATCAGGGTCAGAGCGAATACCGCGCCTTGGCCGACCAGTGGGCCGCAGCAAAGGCAAAGGCCACC
ACGACGAAGCCAGACCCCAAGCCCCAGGGCGAGACGTTGAATCAGCTTCGGAAACGGGCCTACGAGAGCCGCTGG
AGGTGGACTCTAGCTTTCTGGATCTGGCTGCTTTTTATTCACGCCGGAGCTATCTGGCTCTTTGCCAGCGGCTTC
CTCCTCACCCGTCTGGTCCTCGAGCAAAAATCAGAGTGTGGCTCGCCGCCGACCAACAGCAGTCTGGCCCCTTTG
GACGTCGAGCTCGGCTGCTGGCACCCCAAGAAGTTTGAAAGGGCAGTCATCATTGTCATCGATGCACTTCGCTAC
GACTTTACCATCCCGACCACTTCAGACGACACCCGGCATTACCACAATGCGCTGCCGTTCCTACACGAAGAGGCT
GTTGCGCAGCCGCGGAACTCCTTTTTACGTCCTTTTATTGCGGATCCGCCGACGACGACGCTGCAGCGGCTCAAG
GGCCTGACGACGGGCACGCTGCCTACTTTTGTGGACGCGGGGAGTAACTTTGCTGGCACGGCTATTGATGAGGAT
AATTTGTTGATGCAGATGCGGCGGTCGGGCAAGAAGATTGCTCATCTGGGTGATGATACCTGGTGGTCTCTCTTT
CCGGGCTACTTTGAGGCCAACATCTCGAGGGCCTATGACAGCTTCAACGTCTGGGACCTTCACACGGTCGACAAT
GGCGTCATCGACAACATTTTTCCCTTGCTAGAGAAGCAGGGCGGTGGTAATGGCCAGTGGGATCTGCTCATCGGC
CACTGCCTGGGCGTCGACCATGCCGGCCACCGGTACGGGCCCGATCACCCGGCCATGGAGGCCAAGCTGGGTCAG
ATGGACGGTTTTGTGCGGCGGGTGGCGGCCGCCATTGACGATGATACGCTCCTTGTCGTCATGGGCGATCACGGA
ATGGACGCAAAGGGTGACCATGGCGGCGAGAGCGACGACGAGGTCGAGGCCGCGCTCTGGATGTACTCCAAGAGG
CCAGCCTTTGGCCGCACATCACCGGAGCACGCGGTTCCGCCGGCGACGGCCAAGACGCGTCCCGTCAATCAGATT
GATTTGGTGCCGACGCTGGCCCTGCTGCTCGGCATCCCGATCCCGTATAACAGTCTGGGCCGGCCGATCGAGGAG
GCTTTTGTCTCGACAGATGGCGGAGGCGGTAGCGACTGGGCCAACCTGGCGGCCGTCTCCCGCATGTCGGCCGCC
GGCGTGCAGAGATATCAGGAGTCGTACTTTGCGGCCCGCGGCGTCACGCCCGACACGCAACCGGGGTCGCCCGCC
GATCTGTGGGAACGGGCCCGGGCCGAAACCCGGTCAGACGCCGAAACCTACGAGGCCCTGGTACGCTTTCAGGAG
CGCACTCTGCAGGTCTGCAAGGGGCTGTGGGCGCGCTTCGACGTTCCGCGGATGGTGGCGGGTGTGGCCGTTGCG
GCGGCGGGCGTCGTGTTGCTGGCGCTGTACGCGTCGAGGGGCCCGGATGACGAGTATCTTGTCGTCGACGACGTT
GAGCTCGACTATGCCGAGAGGAGGCTTGAGCTGGCGGCCTTTCGGGGCGAGGCGGAGCGACATCCGGACCAGTCG
TACCACCGAGACCTGCTTCGCGGCTTATGGGATATCCGCTTCCTGGCCGTCACGGCGGCGGCGTCGGCGGCCGTT
GTCTTCGGCTGTCGGCAGCGGTCGGTCGATGGAGTGGCTACGGTCATCATGGCACTGATGGTAGCCACTGTCGGG
GCGTCGTTGCACGGAGCCGGCAAGACGGTGGCCCGACTGTTGCCGCGCAACGTCTGGGGCTGGCTGTCGGTATTC
TTTTGCGTCGGACACTCAATTGGGTTCGCTTCCAACTCGTATACGGTATGGGAGGACACGATCCTGCTCTTCTCC
ATCGCCACGTTTGGCGTCGTCGCGGCCGTGGCCTCATTCCGGATCGAGAACCGGGCGGATCGGGCGTTGGCGGTG
TATCACAGTGTCGCGCTGGTGGTGCTCGGCCGGTTGGCGTCGTACTCGAAGCTCTGTCGCGAGGAGCAGATGCCA
TACTGCACGTCGACGTACTACGCGTCGGCGGCGTCGTCTACGTCTGGACCGTGGCAGCTGGCAGTACCATTTGTC
GTCTTTGCGGTGCTTCCGTCGGTGTTGGCATCGTTTCTTCGGCCGACGAGGTCGTACGAGGGCCTGGCTCCTACT
TGGATCGGCTACGTCTTCCGGGCCGGTCTTCTGATGACGGCCATCTACTGGGTCATCGACGCGGCCGATAACGGC
GACTGGCTCGGCGGACGGGTTCCCGAAGGCTCCGTCAAGGCGGCGGGCGTCTACCTGGCGCAACTGAGCCTTGCG
CTGGCGGTGGTGGCGGGCACGACGGCCTTTACATGGGCTCCTCCGTGTGTCTCCGTCGTGCCAGCCGGTCCGTCG
CGGGTGGCCATCTTGGGCTACGGGAATGCCCTGGGCGCACGCTACCTGCTGCTGCCGCTCAACGTGCTGGGCGCG
TGTCTGGCGGTGACGAAGCCCATGGGCGGCGGAGCGCTGGCTCTGATGCTCTGGCAGGTTCTCTCCCTGGCCGAG
GTTGTGGACCTGATCGGTATCCGGGGCGAGACGACGGGGCCCGTGGTTCTGGCCATGCTGGGGAACTTTTACTTC
TTCCGCACGGGACACCAGGCTGCGCTGTCGAGTATCCAGTGGGACAGCGCCTTTGTCGCCCTCTTCACCATCCGT
TACCCCTGGTCCCCCTTGTCGGTAACACTCAACACGTTTGCCGGCCAGATCCTCGCCGCCTCGATATTTCGCCGT
CGAGGCGGTGGCGACGATGACGTGTGCGGGGTGGCTACGGAGGCATCTCATGCTGTACCGGGTGTTTAG
Gene >Ophun1|2427
ATGCCGCCGGATCAGGGTCAGAGCGAATACCGCGCCTTGGCCGACCAGTGGGCCGCAGCAAAGGCAAAGGCCACC
ACGACGAAGCCAGACCCCAAGCCCCAGGGCGAGACGTTGAATCAGCTTCGGAAACGGGCCTACGAGAGCCGCTGG
AGGTGGACTCTAGCTTTCTGGATCTGGCTGCTTTTTATTCACGCCGGAGCTATCTGGCTCTTTGCCAGCGGCTTC
CTCCTCACCCGTCTGGTCCTCGAGCAAAAATCAGAGTGTGGCTCGCCGCCGACCAACAGCAGTCTGGCCCCTTTG
GACGTCGAGCTCGGCTGCTGGCACCCCAAGAAGTTTGAAAGGGCAGTCATCATTGTCATCGATGCACTTCGCTAC
GACTTTACCATCCCGACCACTTCAGACGACACCCGGCATTACCACAATGCGCTGCCGTTCCTACACGAAGAGGCT
GTTGCGCAGCCGCGGAACTCCTTTTTACGTCCTTTTATTGCGGATCCGCCGACGACGACGCTGCAGCGGCTCAAG
GGCCTGACGACGGGCACGCTGCCTACTTTTGTGGACGCGGGGAGTAACTTTGCTGGCACGGCTATTGATGAGGAT
AATTTGTTGATGCAGATGCGGCGGTCGGGCAAGAAGATTGCTCATCTGGGTGATGATACCTGGTGGTCTCTCTTT
CCGGGCTACTTTGAGGCCAACATCTCGAGGGCCTATGACAGCTTCAACGTCTGGGACCTTCACACGGTCGACAAT
GGCGTCATCGACAACATTTTTCCCTTGCTAGAGAAGCAGGGCGGTGGTAATGGCCAGTGGGATCTGCTCATCGGC
CACTGCCTGGGCGTCGACCATGCCGGCCACCGGTACGGGCCCGATCACCCGGCCATGGAGGCCAAGCTGGGTCAG
ATGGACGGTTTTGTGCGGCGGGTGGCGGCCGCCATTGACGATGATACGCTCCTTGTCGTCATGGGCGATCACGGA
ATGGACGCAAAGGGTGACCATGGCGGCGAGAGCGACGACGAGGTCGAGGCCGCGCTCTGGATGTACTCCAAGAGG
CCAGCCTTTGGCCGCACATCACCGGAGCACGCGGTTCCGCCGGCGACGGCCAAGACGCGTCCCGTCAATCAGATT
GATTTGGTGCCGACGCTGGCCCTGCTGCTCGGCATCCCGATCCCGTATAACAGTCTGGGCCGGCCGATCGAGGAG
GCTTTTGTCTCGACAGATGGCGGAGGCGGTAGCGACTGGGCCAACCTGGCGGCCGTCTCCCGCATGTCGGCCGCC
GGCGTGCAGAGATATCAGGAGTCGTACTTTGCGGCCCGCGGCGTCACGCCCGACACGCAACCGGGGTCGCCCGCC
GATCTGTGGGAACGGGCCCGGGCCGAAACCCGGTCAGACGCCGAAACCTACGAGGCCCTGGTACGCTTTCAGGAG
CGCACTCTGCAGGTCTGCAAGGGGCTGTGGGCGCGCTTCGACGTTCCGCGGATGGTGGCGGGTGTGGCCGTTGCG
GCGGCGGGCGTCGTGTTGCTGGCGCTGTACGCGTCGAGGGGCCCGGATGACGAGTATCTTGTCGTCGACGACGTT
GAGCTCGACTATGCCGAGAGGAGGCTTGAGCTGGCGGCCTTTCGGGGCGAGGCGGAGCGACATCCGGACCAGTCG
TACCACCGAGACCTGCTTCGCGGCTTATGGGATATCCGCTTCCTGGCCGTCACGGCGGCGGCGTCGGCGGCCGTT
GTCTTCGGCTGTCGGCAGCGGTCGGTCGATGGAGTGGCTACGGTCATCATGGCACTGATGGTAGCCACTGTCGGG
GCGTCGTTGCACGGAGCCGGCAAGACGGTGGCCCGACTGTTGCCGCGCAACGTCTGGGGCTGGCTGTCGGTATTC
TTTTGCGTCGGACACTCAATTGGGTTCGCTTCCAACTCGTATACGGTATGGGAGGACACGATCCTGCTCTTCTCC
ATCGCCACGTTTGGCGTCGTCGCGGCCGTGGCCTCATTCCGGATCGAGAACCGGGCGGATCGGGCGTTGGCGGTG
TATCACAGTGTCGCGCTGGTGGTGCTCGGCCGGTTGGCGTCGTACTCGAAGCTCTGTCGCGAGGAGCAGATGCCA
TACTGCACGTCGACGTACTACGCGTCGGCGGCGTCGTCTACGTCTGGACCGTGGCAGCTGGCAGTACCATTTGTC
GTCTTTGCGGTGCTTCCGTCGGTGTTGGCATCGTTTCTTCGGCCGACGAGGTCGTACGAGGGCCTGGCTCCTACT
TGGATCGGCTACGTCTTCCGGGCCGGTCTTCTGATGACGGCCATCTACTGGGTCATCGACGCGGCCGATAACGGC
GACTGGCTCGGCGGACGGGTTCCCGAAGGCTCCGTCAAGGCGGCGGGCGTCTACCTGGCGCAACTGAGCCTTGCG
CTGGCGGTGGTGGCGGGCACGACGGCCTTTACATGGGCTCCTCCGTGTGTCTCCGTCGTGCCAGCCGGTCCGTCG
CGGGTGGCCATCTTGGGCTACGGGAATGCCCTGGGCGCACGCTACCTGCTGCTGCCGCTCAACGTGCTGGGCGCG
TGTCTGGCGGTGACGAAGCCCATGGGCGGCGGAGCGCTGGCTCTGATGCTCTGGCAGGTTCTCTCCCTGGCCGAG
GTTGTGGACCTGATCGGTATCCGGGGCGAGACGACGGGGCCCGTGGTTCTGGCCATGCTGGGGAACTTTTACTTC
TTCCGCACGGGACACCAGGCTGCGCTGTCGAGTATCCAGTGGGACAGCGCCTTTGTCGCCCTCTTCACCATCCGT
TACCCCTGGTCCCCCTTGTCGGTAACACTCAACACGTTTGCCGGCCAGATCCTCGCCGCCTCGTGCGTTCCTTTG
CTCTGTCTCTGGAAAGCCGGACCGAAGCAAAGAGCGAGTCTGGAGGCGGTGACGCGCTCGTGCGCCGCGTTTGCA
GGATATTTCGCCGTCGAGGCGGTGGCGACGATGACGTGTGCGGGGTGGCTACGGAGGCATCTCATGCTGTACCGG
GTGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail