Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2424
Gene name
LocationContig_22:31849..33631
Strand+
Gene length (bp)1782
Transcript length (bp)1629
Coding sequence length (bp)1629
Protein length (aa) 543

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 1.0E-110 10 491
PF07690 MFS_1 Major Facilitator Superfamily 2.8E-30 63 367

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49374|HGT1_KLULA High-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HGT1 PE=3 SV=1 5 542 2.0E-152
sp|O74713|HGT1_CANAX High-affinity glucose transporter OS=Candida albicans GN=HGT1 PE=3 SV=1 3 540 3.0E-125
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 5 539 2.0E-61
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 16 492 3.0E-59
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 15 496 3.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49374|HGT1_KLULA High-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HGT1 PE=3 SV=1 5 542 2.0E-152
sp|O74713|HGT1_CANAX High-affinity glucose transporter OS=Candida albicans GN=HGT1 PE=3 SV=1 3 540 3.0E-125
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 5 539 2.0E-61
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 16 492 3.0E-59
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 15 496 3.0E-59
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 7 489 4.0E-59
sp|P10870|SNF3_YEAST High-affinity glucose transporter SNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF3 PE=1 SV=3 15 491 1.0E-58
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 12 486 4.0E-58
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 48 491 9.0E-58
sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT2 PE=1 SV=1 15 497 4.0E-57
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 60 528 2.0E-56
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 16 508 3.0E-56
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 60 505 5.0E-56
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 7 501 7.0E-56
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 7 501 7.0E-56
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 9 501 7.0E-56
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 60 528 8.0E-56
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 15 493 8.0E-56
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 5 501 1.0E-55
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 5 501 1.0E-55
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 6 539 1.0E-55
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 60 505 2.0E-55
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 9 498 2.0E-55
sp|P18631|RAG1_KLULA Low-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG1 PE=1 SV=1 16 539 4.0E-55
sp|P43581|HXT10_YEAST Hexose transporter HXT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT10 PE=1 SV=1 16 493 3.0E-54
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 6 492 3.0E-54
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 6 492 3.0E-54
sp|Q9LT15|STP10_ARATH Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1 12 486 6.0E-54
sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 PE=1 SV=2 16 493 2.0E-53
sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 PE=1 SV=1 16 493 2.0E-53
sp|P78831|GHT5_SCHPO High-affinity glucose transporter ght5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght5 PE=1 SV=2 5 539 4.0E-53
sp|Q8TFG1|GHT7_SCHPO Probable high-affinity hexose transporter ght7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght7 PE=3 SV=1 63 491 4.0E-53
sp|Q9LNV3|STP2_ARATH Sugar transport protein 2 OS=Arabidopsis thaliana GN=STP2 PE=1 SV=3 4 486 8.0E-53
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 7 491 8.0E-53
sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1 16 507 9.0E-53
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 3 490 1.0E-52
sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT9 PE=1 SV=1 16 507 2.0E-52
sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3 16 539 2.0E-52
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 15 491 2.0E-52
sp|P32466|HXT3_YEAST Low-affinity glucose transporter HXT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT3 PE=1 SV=1 7 524 6.0E-52
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 4 493 7.0E-52
sp|P15729|GLCP_SYNY3 Glucose transport protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gtr PE=3 SV=2 6 486 1.0E-51
sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT5 PE=1 SV=1 6 493 3.0E-51
sp|Q9P3U6|GHT1_SCHPO High-affinity glucose transporter ght1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght1 PE=1 SV=1 15 537 4.0E-51
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 63 496 9.0E-50
sp|Q9P3U7|GHT8_SCHPO Probable high-affinity hexose transporter ght8, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght8 PE=1 SV=1 15 538 2.0E-49
sp|P15686|HUP1_PARKE H(+)/hexose cotransporter 1 OS=Parachlorella kessleri GN=HUP1 PE=2 SV=2 6 491 2.0E-49
sp|Q4U3U6|QAY_NEUAF Quinate permease OS=Neurospora africana GN=qa-y PE=3 SV=1 6 491 5.0E-49
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 74 492 5.0E-49
sp|P11636|QAY_NEUCR Quinate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-y PE=3 SV=2 6 492 9.0E-49
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 6 529 1.0E-48
sp|Q39524|HUP2_PARKE H(+)/hexose cotransporter 2 OS=Parachlorella kessleri GN=HUP2 PE=2 SV=1 6 491 2.0E-48
sp|Q39228|STP4_ARATH Sugar transport protein 4 OS=Arabidopsis thaliana GN=STP4 PE=1 SV=1 5 486 7.0E-48
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 6 492 1.0E-47
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 16 493 2.0E-47
sp|P15325|QUTD_EMENI Quinate permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutD PE=1 SV=2 6 521 3.0E-47
sp|Q9FMX3|STP11_ARATH Sugar transport protein 11 OS=Arabidopsis thaliana GN=STP11 PE=1 SV=1 6 493 6.0E-47
sp|C7GWV6|HXT4_YEAS2 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain JAY291) GN=HXT4 PE=3 SV=1 119 539 6.0E-47
sp|Q39525|HUP3_PARKE H(+)/hexose cotransporter 3 OS=Parachlorella kessleri GN=HUP3 PE=2 SV=1 6 491 6.0E-47
sp|A6ZT02|HXT4_YEAS7 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain YJM789) GN=HXT4 PE=3 SV=1 119 539 8.0E-47
sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 PE=1 SV=1 119 539 8.0E-47
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 48 491 1.0E-46
sp|Q9SBA7|STP8_ARATH Sugar transport protein 8 OS=Arabidopsis thaliana GN=STP8 PE=2 SV=2 6 486 2.0E-46
sp|Q0D135|QUTD_ASPTN Probable quinate permease OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=qutD PE=3 SV=1 5 537 8.0E-46
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 5 492 8.0E-46
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 5 492 8.0E-46
sp|P43562|YFE0_YEAST Probable metabolite transport protein YFL040W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL040W PE=1 SV=1 9 531 1.0E-45
sp|Q6MYX6|QUTD_ASPFU Probable quinate permease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=qutD PE=3 SV=1 5 527 3.0E-45
sp|Q8GW61|STP14_ARATH Sugar transport protein 14 OS=Arabidopsis thaliana GN=STP14 PE=2 SV=2 12 487 6.0E-45
sp|Q0WWW9|XYLL3_ARATH D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana GN=At5g59250 PE=2 SV=2 15 489 2.0E-44
sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT8 PE=1 SV=1 16 539 3.0E-44
sp|Q6GN01|GTR10_XENLA Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus laevis GN=slc2a10 PE=2 SV=1 63 488 5.0E-44
sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 60 488 6.0E-44
sp|P40441|HXT12_YEAST Putative hexose transporter 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT12 PE=5 SV=1 64 507 6.0E-44
sp|Q9SFG0|STP6_ARATH Sugar transport protein 6 OS=Arabidopsis thaliana GN=STP6 PE=1 SV=1 6 495 8.0E-44
sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 73 490 9.0E-44
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 68 493 1.0E-43
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 20 491 1.0E-43
sp|Q94AZ2|STP13_ARATH Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2 89 486 2.0E-43
sp|O04249|STP7_ARATH Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1 7 486 2.0E-43
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 6 493 7.0E-43
sp|A1D2R3|QUTD_NEOFI Probable quinate permease OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=qutD PE=3 SV=1 5 538 8.0E-43
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 53 492 1.0E-42
sp|Q9FRL3|ERDL6_ARATH Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana GN=At1g75220 PE=1 SV=1 73 492 2.0E-42
sp|P47843|GTR3_SHEEP Solute carrier family 2, facilitated glucose transporter member 3 OS=Ovis aries GN=SLC2A3 PE=2 SV=1 68 492 3.0E-42
sp|O44827|FGT1_CAEEL Facilitated glucose transporter protein 1 OS=Caenorhabditis elegans GN=fgt-1 PE=1 SV=2 51 493 3.0E-42
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 6 486 4.0E-42
sp|Q8LBI9|EDL16_ARATH Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2 70 489 9.0E-42
sp|Q07647|GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus GN=Slc2a3 PE=1 SV=1 68 492 1.0E-41
sp|P58352|GTR3_BOVIN Solute carrier family 2, facilitated glucose transporter member 3 OS=Bos taurus GN=SLC2A3 PE=2 SV=1 11 492 1.0E-41
sp|Q6AWX0|XYLL2_ARATH D-xylose-proton symporter-like 2 OS=Arabidopsis thaliana GN=At5g17010 PE=1 SV=1 64 489 2.0E-41
sp|Q10710|STA_RICCO Sugar carrier protein A OS=Ricinus communis GN=STA PE=2 SV=1 6 486 2.0E-41
sp|P42833|HXT14_YEAST Hexose transporter HXT14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT14 PE=1 SV=2 8 492 4.0E-41
sp|A1CPX0|QUTD_ASPCL Probable quinate permease OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=qutD PE=3 SV=1 5 527 4.0E-41
sp|Q3ECP7|ERDL5_ARATH Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2 70 488 7.0E-41
sp|P47842|GTR3_CANLF Solute carrier family 2, facilitated glucose transporter member 3 OS=Canis lupus familiaris GN=SLC2A3 PE=2 SV=1 68 492 8.0E-41
sp|P23586|STP1_ARATH Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2 12 486 8.0E-41
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 61 488 9.0E-41
sp|B4QBN3|TRE12_DROSI Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila simulans GN=Tret1-2 PE=3 SV=1 72 488 1.0E-40
sp|P11169|GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens GN=SLC2A3 PE=1 SV=1 68 492 1.0E-40
sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 73 492 1.0E-40
sp|Q93Y91|STP5_ARATH Sugar transport protein 5 OS=Arabidopsis thaliana GN=STP5 PE=2 SV=1 67 493 2.0E-40
sp|Q5R608|GTR3_PONAB Solute carrier family 2, facilitated glucose transporter member 3 OS=Pongo abelii GN=SLC2A3 PE=2 SV=1 68 492 2.0E-40
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 66 497 2.0E-40
sp|P32037|GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus GN=Slc2a3 PE=1 SV=1 68 492 2.0E-40
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 72 488 3.0E-40
sp|B4HNS1|TRE12_DROSE Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila sechellia GN=Tret1-2 PE=3 SV=1 72 488 3.0E-40
sp|A9ZSY2|TRET1_APILI Facilitated trehalose transporter Tret1 OS=Apis mellifera ligustica GN=Tret1 PE=1 SV=1 59 494 5.0E-40
sp|P07921|LACP_KLULA Lactose permease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC12 PE=3 SV=1 5 539 8.0E-40
sp|O04036|ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3 70 493 1.0E-39
sp|Q0WQ63|ERDL8_ARATH Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana GN=At3g05150 PE=2 SV=1 73 490 1.0E-39
sp|Q9XSC2|GTR3_RABIT Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Oryctolagus cuniculus GN=SLC2A3 PE=2 SV=1 93 492 1.0E-39
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 4 493 4.0E-39
sp|Q04162|YD387_YEAST Probable metabolite transport protein YDR387C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR387C PE=1 SV=1 13 500 4.0E-39
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 6 519 5.0E-39
sp|Q8L6Z8|XYLL1_ARATH D-xylose-proton symporter-like 1 OS=Arabidopsis thaliana GN=At3g03090 PE=2 SV=1 64 489 7.0E-39
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 12 493 7.0E-39
sp|Q9NY64|GTR8_HUMAN Solute carrier family 2, facilitated glucose transporter member 8 OS=Homo sapiens GN=SLC2A8 PE=1 SV=3 71 492 8.0E-39
sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 7 488 1.0E-38
sp|Q10286|ITR1_SCHPO Myo-inositol transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr1 PE=3 SV=1 6 498 2.0E-38
sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 72 488 2.0E-38
sp|B0XQS8|QUTD_ASPFC Probable quinate permease OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=qutD PE=3 SV=1 5 527 2.0E-38
sp|Q8TDB8|GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens GN=SLC2A14 PE=2 SV=1 68 492 2.0E-38
sp|B4MYA4|TRET1_DROWI Facilitated trehalose transporter Tret1 OS=Drosophila willistoni GN=Tret1 PE=3 SV=1 72 488 2.0E-38
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 60 492 2.0E-38
sp|Q4F7G0|ERDL2_ARATH Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1 67 489 3.0E-38
sp|P58354|GTR8_BOVIN Solute carrier family 2, facilitated glucose transporter member 8 OS=Bos taurus GN=SLC2A8 PE=2 SV=2 72 492 4.0E-38
sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 67 488 9.0E-38
sp|Q9JJZ1|GTR8_RAT Solute carrier family 2, facilitated glucose transporter member 8 OS=Rattus norvegicus GN=Slc2a8 PE=1 SV=1 24 492 1.0E-37
sp|O65413|STP12_ARATH Sugar transport protein 12 OS=Arabidopsis thaliana GN=STP12 PE=2 SV=1 6 486 1.0E-37
sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 72 488 2.0E-37
sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 72 488 2.0E-37
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 6 350 2.0E-37
sp|Q94KE0|ERDL3_ARATH Sugar transporter ERD6-like 3 OS=Arabidopsis thaliana GN=SUGTL2 PE=2 SV=1 70 493 3.0E-37
sp|B4J913|TRET1_DROGR Facilitated trehalose transporter Tret1 OS=Drosophila grimshawi GN=Tret1 PE=3 SV=1 83 488 3.0E-37
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 6 508 4.0E-37
sp|P21906|GLF_ZYMMO Glucose facilitated diffusion protein OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glf PE=3 SV=2 4 493 5.0E-37
sp|A5LGM7|TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki GN=Tret1 PE=1 SV=1 83 488 9.0E-37
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 74 491 1.0E-36
sp|Q9JIF3|GTR8_MOUSE Solute carrier family 2, facilitated glucose transporter member 8 OS=Mus musculus GN=Slc2a8 PE=1 SV=2 24 492 1.0E-36
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 74 491 1.0E-36
sp|Q8L7R8|STP3_ARATH Sugar transport protein 3 OS=Arabidopsis thaliana GN=STP3 PE=2 SV=2 7 493 1.0E-36
sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 73 498 1.0E-36
sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 72 488 2.0E-36
sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens GN=SLC2A1 PE=1 SV=2 68 503 4.0E-36
sp|P46896|GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus GN=SLC2A1 PE=2 SV=1 68 503 6.0E-36
sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 89 488 8.0E-36
sp|Q9LTP6|EDL13_ARATH Putative sugar transporter ERD6-like 13 OS=Arabidopsis thaliana GN=At3g20460 PE=3 SV=2 68 489 1.0E-35
sp|Q8IRI6|GTR1_DROME Glucose transporter type 1 OS=Drosophila melanogaster GN=Glut1 PE=2 SV=4 84 501 1.0E-35
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 59 488 1.0E-35
sp|Q9SCW7|ERDL1_ARATH Sugar transporter ERD6-like 1 OS=Arabidopsis thaliana GN=SUGTL4 PE=2 SV=2 67 488 1.0E-35
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 15 347 2.0E-35
sp|Q0P4G6|GTR10_XENTR Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus tropicalis GN=slc2a10 PE=2 SV=1 63 352 3.0E-35
sp|P20303|GTR1_PIG Solute carrier family 2, facilitated glucose transporter member 1 OS=Sus scrofa GN=SLC2A1 PE=2 SV=2 68 503 3.0E-35
sp|P27674|GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus GN=SLC2A1 PE=1 SV=1 68 503 5.0E-35
sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 70 495 6.0E-35
sp|Q7PIR5|TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae GN=Tret1 PE=1 SV=3 72 488 9.0E-35
sp|P11167|GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus GN=Slc2a1 PE=1 SV=1 68 503 9.0E-35
sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 72 488 1.0E-34
sp|P17809|GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus GN=Slc2a1 PE=1 SV=4 68 503 1.0E-34
sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 72 488 2.0E-34
sp|P13355|GTR1_RABIT Solute carrier family 2, facilitated glucose transporter member 1 OS=Oryctolagus cuniculus GN=SLC2A1 PE=2 SV=1 68 503 3.0E-34
sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 72 488 3.0E-34
sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus GN=Slc2a2 PE=1 SV=3 51 518 5.0E-34
sp|Q8VZT3|EDL12_ARATH Sugar transporter ERD6-like 12 OS=Arabidopsis thaliana GN=SUGTL5 PE=2 SV=1 73 493 7.0E-34
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 15 347 8.0E-34
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 89 350 1.0E-33
sp|Q94CI7|EDL17_ARATH Sugar transporter ERD6-like 17 OS=Arabidopsis thaliana GN=SFP1 PE=2 SV=2 73 495 2.0E-33
sp|B4HNS0|TRE11_DROSE Facilitated trehalose transporter Tret1-1 OS=Drosophila sechellia GN=Tret1-1 PE=3 SV=1 72 488 2.0E-33
sp|Q9FYG3|PLST2_ARATH Probable plastidic glucose transporter 2 OS=Arabidopsis thaliana GN=At1g67300 PE=2 SV=1 61 488 2.0E-33
sp|P12336|GTR2_RAT Solute carrier family 2, facilitated glucose transporter member 2 OS=Rattus norvegicus GN=Slc2a2 PE=2 SV=1 68 518 3.0E-33
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 6 350 4.0E-33
sp|Q94AF9|EDL11_ARATH Sugar transporter ERD6-like 11 OS=Arabidopsis thaliana GN=At3g05165 PE=2 SV=2 70 489 8.0E-33
sp|P11168|GTR2_HUMAN Solute carrier family 2, facilitated glucose transporter member 2 OS=Homo sapiens GN=SLC2A2 PE=1 SV=1 40 496 9.0E-33
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucose transporter member 5 OS=Bos taurus GN=SLC2A5 PE=1 SV=2 73 497 1.0E-32
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 73 497 1.0E-32
sp|Q9M0Z9|EDL15_ARATH Sugar transporter ERD6-like 15 OS=Arabidopsis thaliana GN=At4g04760 PE=3 SV=2 70 493 4.0E-32
sp|A1Z8N1|TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster GN=Tret1-1 PE=1 SV=1 72 488 5.0E-32
sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 73 489 7.0E-32
sp|P79365|GTR1_SHEEP Solute carrier family 2, facilitated glucose transporter member 1 (Fragment) OS=Ovis aries GN=SLC2A1 PE=2 SV=1 112 503 8.0E-32
sp|Q7XA64|ERDL9_ARATH Sugar transporter ERD6-like 9 OS=Arabidopsis thaliana GN=At3g05155 PE=2 SV=1 73 347 8.0E-32
sp|Q8TD20|GTR12_HUMAN Solute carrier family 2, facilitated glucose transporter member 12 OS=Homo sapiens GN=SLC2A12 PE=2 SV=1 63 353 1.0E-31
sp|Q9BE72|GTR12_MACFA Solute carrier family 2, facilitated glucose transporter member 12 OS=Macaca fascicularis GN=SLC2A12 PE=2 SV=1 63 353 1.0E-31
sp|Q8BFW9|GTR12_MOUSE Solute carrier family 2, facilitated glucose transporter member 12 OS=Mus musculus GN=Slc2a12 PE=2 SV=1 63 358 2.0E-31
sp|Q90592|GTR2_CHICK Solute carrier family 2, facilitated glucose transporter member 2 OS=Gallus gallus GN=SLC2A2 PE=2 SV=1 71 492 2.0E-31
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 84 364 3.0E-31
sp|Q5J316|GTR12_BOVIN Solute carrier family 2, facilitated glucose transporter member 12 OS=Bos taurus GN=SLC2A12 PE=1 SV=1 63 353 5.0E-31
sp|Q2V4B9|PLST3_ARATH Probable plastidic glucose transporter 3 OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2 61 488 8.0E-31
sp|Q32NG5|GTR12_XENLA Solute carrier family 2, facilitated glucose transporter member 12 OS=Xenopus laevis GN=slc2a12 PE=2 SV=1 63 358 1.0E-30
sp|P43427|GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus GN=Slc2a5 PE=1 SV=1 73 497 2.0E-30
sp|Q9WV38|GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus GN=Slc2a5 PE=1 SV=2 73 498 8.0E-30
sp|Q9UGQ3|GTR6_HUMAN Solute carrier family 2, facilitated glucose transporter member 6 OS=Homo sapiens GN=SLC2A6 PE=1 SV=2 73 492 9.0E-30
sp|Q27994|GTR4_BOVIN Solute carrier family 2, facilitated glucose transporter member 4 OS=Bos taurus GN=SLC2A4 PE=2 SV=2 8 537 3.0E-28
sp|P14672|GTR4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 OS=Homo sapiens GN=SLC2A4 PE=1 SV=1 8 492 4.0E-28
sp|P58351|GTR2_BOVIN Solute carrier family 2, facilitated glucose transporter member 2 OS=Bos taurus GN=SLC2A2 PE=2 SV=2 68 439 5.0E-28
sp|P19357|GTR4_RAT Solute carrier family 2, facilitated glucose transporter member 4 OS=Rattus norvegicus GN=Slc2a4 PE=1 SV=1 8 492 1.0E-27
sp|P14142|GTR4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus GN=Slc2a4 PE=1 SV=3 8 492 1.0E-26
sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens GN=SLC2A7 PE=2 SV=2 86 498 4.0E-26
sp|A4ZYQ5|GTR7_RAT Solute carrier family 2, facilitated glucose transporter member 7 OS=Rattus norvegicus GN=Slc2a7 PE=2 SV=1 86 498 3.0E-25
sp|P0C6A1|GTR7_MOUSE Solute carrier family 2, facilitated glucose transporter member 7 OS=Mus musculus GN=Slc2a7 PE=3 SV=1 73 499 5.0E-24
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 62 240 9.0E-24
sp|Q6NWF1|GTR12_DANRE Solute carrier family 2, facilitated glucose transporter member 12 OS=Danio rerio GN=slc2a12 PE=2 SV=2 86 379 5.0E-23
sp|Q5RET7|GTR5_PONAB Solute carrier family 2, facilitated glucose transporter member 5 OS=Pongo abelii GN=SLC2A5 PE=2 SV=1 73 498 7.0E-23
sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens GN=SLC2A9 PE=1 SV=2 71 495 1.0E-22
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 62 239 1.0E-22
sp|P0CE00|MPH3_YEAST Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH3 PE=1 SV=1 63 492 2.0E-22
sp|A6ZX88|MPH3_YEAS7 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain YJM789) GN=MPH3 PE=3 SV=1 63 492 2.0E-22
sp|B5VF36|MPH3_YEAS6 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MPH3 PE=3 SV=1 63 492 2.0E-22
sp|Q863Y9|GTR5_HORSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Equus caballus GN=SLC2A5 PE=2 SV=1 73 498 2.0E-22
sp|P0CD99|MPH2_YEAST Alpha-glucosides permease MPH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH2 PE=2 SV=1 63 492 2.0E-22
sp|O44616|FGTH1_CAEEL Facilitated glucose transporter homolog OS=Caenorhabditis elegans GN=R09B5.11 PE=1 SV=2 60 447 3.0E-22
sp|C8Z6M6|MPH3_YEAS8 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MPH3 PE=3 SV=1 63 492 4.0E-22
sp|Q5RB09|GTR9_PONAB Solute carrier family 2, facilitated glucose transporter member 9 OS=Pongo abelii GN=SLC2A9 PE=2 SV=1 71 495 4.0E-22
sp|P15685|MAL61_YEASX Maltose permease MAL61 OS=Saccharomyces cerevisiae GN=MAL61 PE=3 SV=1 63 538 5.0E-22
sp|P38156|MAL31_YEAST Maltose permease MAL31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL31 PE=1 SV=1 63 538 3.0E-21
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 62 239 2.0E-19
sp|P46408|GTR5_RABIT Solute carrier family 2, facilitated glucose transporter member 5 OS=Oryctolagus cuniculus GN=SLC2A5 PE=2 SV=1 66 498 1.0E-18
sp|P22732|GTR5_HUMAN Solute carrier family 2, facilitated glucose transporter member 5 OS=Homo sapiens GN=SLC2A5 PE=1 SV=1 73 498 1.0E-18
sp|O95528|GTR10_HUMAN Solute carrier family 2, facilitated glucose transporter member 10 OS=Homo sapiens GN=SLC2A10 PE=1 SV=2 82 353 2.0E-18
sp|P38142|YB91_YEAST Probable metabolite transport protein YBR241C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR241C PE=1 SV=1 4 483 1.0E-17
sp|P53142|VPS73_YEAST Vacuolar protein sorting-associated protein 73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS73 PE=1 SV=1 12 369 2.0E-17
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 64 490 3.0E-17
sp|Q9BYW1|GTR11_HUMAN Solute carrier family 2, facilitated glucose transporter member 11 OS=Homo sapiens GN=SLC2A11 PE=2 SV=1 6 512 1.0E-16
sp|Q8VHD6|GTR10_MOUSE Solute carrier family 2, facilitated glucose transporter member 10 OS=Mus musculus GN=Slc2a10 PE=2 SV=1 6 353 9.0E-16
sp|Q94DB8|PT111_ORYSJ Inorganic phosphate transporter 1-11 OS=Oryza sativa subsp. japonica GN=PHT1-11 PE=2 SV=1 5 486 3.0E-13
sp|Q9U539|OCT1_CAEEL Organic cation transporter 1 OS=Caenorhabditis elegans GN=oct-1 PE=1 SV=3 67 533 1.0E-11
sp|P53048|MAL11_YEAST General alpha-glucoside permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL11 PE=1 SV=1 63 506 5.0E-11
sp|P07661|CITA_ECOLX Citrate-proton symporter OS=Escherichia coli GN=citA PE=3 SV=1 76 224 5.0E-11
sp|Q6A4L0|S22AD_MOUSE Solute carrier family 22 member 13 OS=Mus musculus GN=Slc22a13 PE=1 SV=3 72 526 7.0E-11
sp|Q0P4G6|GTR10_XENTR Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus tropicalis GN=slc2a10 PE=2 SV=1 399 492 8.0E-11
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 66 280 8.0E-11
sp|Q9Y226|S22AD_HUMAN Solute carrier family 22 member 13 OS=Homo sapiens GN=SLC22A13 PE=2 SV=2 47 487 1.0E-10
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 398 519 3.0E-10
sp|P13865|PRO1_LEIEN Probable transport protein OS=Leishmania enriettii GN=PRO-1 PE=2 SV=1 51 484 3.0E-10
sp|O76082|S22A5_HUMAN Solute carrier family 22 member 5 OS=Homo sapiens GN=SLC22A5 PE=1 SV=1 72 504 4.0E-10
sp|P0A2G3|CITA_SALTY Citrate-proton symporter OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=citA PE=3 SV=1 76 233 4.0E-10
sp|P0A2G4|CITA_SALTI Citrate-proton symporter OS=Salmonella typhi GN=citA PE=3 SV=1 76 233 4.0E-10
sp|Q8VHD6|GTR10_MOUSE Solute carrier family 2, facilitated glucose transporter member 10 OS=Mus musculus GN=Slc2a10 PE=2 SV=1 393 492 7.0E-10
sp|Q9SA38|OCT3_ARATH Organic cation/carnitine transporter 3 OS=Arabidopsis thaliana GN=OCT3 PE=2 SV=1 54 487 1.0E-09
sp|Q504N2|S22AF_MOUSE Solute carrier family 22 member 15 OS=Mus musculus GN=Slc22a15 PE=2 SV=3 73 487 2.0E-09
sp|Q69ZS6|SV2C_MOUSE Synaptic vesicle glycoprotein 2C OS=Mus musculus GN=Sv2c PE=1 SV=2 73 264 2.0E-09
sp|Q7ZX53|S22FL_XENLA Solute carrier family 22 member 15-like OS=Xenopus laevis GN=slc22a15b PE=2 SV=1 72 494 3.0E-09
sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 73 264 3.0E-09
sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 73 264 3.0E-09
sp|P16482|CITH_KLEPN Citrate-proton symporter OS=Klebsiella pneumoniae GN=citH PE=3 SV=1 76 220 3.0E-09
sp|P53403|GTR3_DROME Glucose transporter type 3 OS=Drosophila melanogaster GN=Glut3 PE=2 SV=1 58 479 4.0E-09
sp|Q9Z2I6|SV2C_RAT Synaptic vesicle glycoprotein 2C OS=Rattus norvegicus GN=Sv2c PE=1 SV=1 73 264 4.0E-09
sp|O95528|GTR10_HUMAN Solute carrier family 2, facilitated glucose transporter member 10 OS=Homo sapiens GN=SLC2A10 PE=1 SV=2 393 493 5.0E-09
sp|Q496J9|SV2C_HUMAN Synaptic vesicle glycoprotein 2C OS=Homo sapiens GN=SV2C PE=1 SV=1 73 264 7.0E-09
sp|Q8TD20|GTR12_HUMAN Solute carrier family 2, facilitated glucose transporter member 12 OS=Homo sapiens GN=SLC2A12 PE=2 SV=1 393 498 1.0E-08
sp|Q9BE72|GTR12_MACFA Solute carrier family 2, facilitated glucose transporter member 12 OS=Macaca fascicularis GN=SLC2A12 PE=2 SV=1 393 498 1.0E-08
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 380 492 1.0E-08
sp|Q5J316|GTR12_BOVIN Solute carrier family 2, facilitated glucose transporter member 12 OS=Bos taurus GN=SLC2A12 PE=1 SV=1 393 498 1.0E-08
sp|Q8IZD6|S22AF_HUMAN Solute carrier family 22 member 15 OS=Homo sapiens GN=SLC22A15 PE=2 SV=1 72 487 1.0E-08
sp|Q8BFW9|GTR12_MOUSE Solute carrier family 2, facilitated glucose transporter member 12 OS=Mus musculus GN=Slc2a12 PE=2 SV=1 393 498 2.0E-08
sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=1 SV=1 73 264 2.0E-08
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 398 534 3.0E-08
sp|Q63ZE4|S22AA_HUMAN Solute carrier family 22 member 10 OS=Homo sapiens GN=SLC22A10 PE=2 SV=2 59 493 6.0E-08
sp|Q9H015|S22A4_HUMAN Solute carrier family 22 member 4 OS=Homo sapiens GN=SLC22A4 PE=1 SV=3 67 487 6.0E-08
sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1 53 264 6.0E-08
sp|Q02563|SV2A_RAT Synaptic vesicle glycoprotein 2A OS=Rattus norvegicus GN=Sv2a PE=1 SV=2 53 264 7.0E-08
sp|Q5R4L9|SV2A_PONAB Synaptic vesicle glycoprotein 2A OS=Pongo abelii GN=SV2A PE=2 SV=1 53 264 7.0E-08
sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 53 264 8.0E-08
sp|Q9JIS5|SV2A_MOUSE Synaptic vesicle glycoprotein 2A OS=Mus musculus GN=Sv2a PE=1 SV=1 53 264 8.0E-08
sp|Q29397|SV2A_BOVIN Synaptic vesicle glycoprotein 2A OS=Bos taurus GN=SV2A PE=2 SV=1 53 264 9.0E-08
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 376 492 1.0E-07
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 398 534 1.0E-07
sp|Q9R141|S22A4_RAT Solute carrier family 22 member 4 OS=Rattus norvegicus GN=Slc22a4 PE=1 SV=1 67 498 1.0E-07
sp|A9CB25|S22A4_PAPAN Solute carrier family 22 member 4 OS=Papio anubis GN=SLC22A4 PE=3 SV=1 67 508 1.0E-07
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 398 492 2.0E-07
sp|Q32NG5|GTR12_XENLA Solute carrier family 2, facilitated glucose transporter member 12 OS=Xenopus laevis GN=slc2a12 PE=2 SV=1 399 486 2.0E-07
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 269 485 2.0E-07
sp|O62787|GTR3_PIG Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Sus scrofa GN=SLC2A3 PE=2 SV=1 121 217 2.0E-07
sp|O75751|S22A3_HUMAN Solute carrier family 22 member 3 OS=Homo sapiens GN=SLC22A3 PE=1 SV=1 68 503 3.0E-07
sp|P76230|YDJK_ECOLI Putative metabolite transport protein YdjK OS=Escherichia coli (strain K12) GN=ydjK PE=3 SV=1 67 429 5.0E-07
sp|P38055|YDJE_ECOLI Inner membrane metabolite transport protein YdjE OS=Escherichia coli (strain K12) GN=ydjE PE=1 SV=2 60 427 8.0E-07
sp|Q9Z306|S22A4_MOUSE Solute carrier family 22 member 4 OS=Mus musculus GN=Slc22a4 PE=1 SV=1 67 498 3.0E-06
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 228 491 4.0E-06
sp|Q6NUB3|S22AF_XENLA Solute carrier family 22 member 15 OS=Xenopus laevis GN=slc22a15 PE=2 SV=2 72 487 4.0E-06
sp|Q9VCA2|ORCT_DROME Organic cation transporter protein OS=Drosophila melanogaster GN=Orct PE=1 SV=1 59 432 6.0E-06
sp|Q9WTW5|S22A3_MOUSE Solute carrier family 22 member 3 OS=Mus musculus GN=Slc22a3 PE=2 SV=1 68 535 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 62 84 22
3 97 119 22
4 157 176 19
5 189 211 22
6 278 300 22
7 313 335 22
8 345 367 22
9 391 413 22
10 428 450 22
11 457 476 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2424
MPIGNIYVIAAVSVVGGGLFGFDISSLSAQLGEQAYLCYFNQGPSGPPFNDDEKCTGPRDVVQGGITAAMAAGSW
LGALASGPLSDRAGRRYSIMVGCVIWVIGSSIICASQSIPMLVVGRLINGFCVGIESAQVPVYIAEISPPSKRGR
FIGMQQWAITWGILIMYYISYGCSFIGEQNSRNYREAAWRIPWGLQMVPAIFLFFMMMFLPESPRWLARKGRWDE
CRSVLALVHGKGDVDHPFVAYEMDDIKQMCEFEQRHSNVTYLDLFKPNMIHRTIIGLFTQIWSQLTGMNVMMYYI
TFVFRMAGYTDSAGLLASSISYIINVIMTVPAILYVDRWGRRPTLLIGSLLMATWMFANAGILAAHGQVVEGGID
HVSSQSMLVTGAPAKGLIACTYLFVASFAPTWGPVSWIYPPELFPLRLRGKGVALATSGNWAFNTALGFFVPPAL
ANIKWRTYLLFGVFNIAAFFHVLFVFPETAGKTLEETEAMFEDPNGIKYLGTPAWKTRVVTKLVNQAEHGEVDAK
RQTQYHMSDVHDEKTAL*
Coding >Ophun1|2424
ATGCCCATCGGCAACATCTACGTCATTGCCGCCGTCTCCGTTGTGGGCGGCGGCCTGTTCGGCTTCGACATCTCG
TCGCTTTCTGCGCAGTTGGGCGAGCAGGCTTATCTGTGCTACTTTAATCAGGGGCCTTCGGGGCCGCCGTTTAAC
GACGATGAGAAGTGTACGGGGCCGAGGGATGTGGTGCAGGGAGGGATTACGGCGGCCATGGCGGCTGGATCGTGG
CTTGGGGCCTTGGCTTCGGGGCCGTTGAGTGATCGGGCTGGGAGGAGGTATTCCATCATGGTTGGTTGTGTCATC
TGGGTCATCGGCTCCTCCATCATCTGCGCCTCCCAGAGCATCCCCATGCTCGTCGTGGGCCGCCTCATCAACGGC
TTCTGCGTCGGCATCGAATCCGCCCAAGTGCCCGTCTACATCGCCGAAATCTCACCTCCGTCGAAACGCGGCCGC
TTCATCGGCATGCAGCAATGGGCCATCACCTGGGGCATCCTCATCATGTACTACATCTCGTACGGCTGCTCCTTC
ATCGGAGAGCAGAACTCGCGCAACTACCGCGAGGCTGCCTGGCGGATCCCCTGGGGTCTGCAGATGGTGCCGGCC
ATCTTCCTCTTCTTCATGATGATGTTCTTGCCCGAGTCTCCCCGGTGGTTGGCCAGGAAGGGTCGGTGGGATGAG
TGTCGGTCGGTGCTGGCGCTTGTTCATGGTAAGGGGGATGTTGATCATCCGTTTGTTGCCTATGAGATGGACGAC
ATCAAGCAGATGTGCGAGTTTGAGCAGCGTCACTCCAACGTCACGTACCTGGATCTCTTCAAGCCCAACATGATC
CACCGGACCATCATCGGCCTCTTTACTCAGATCTGGTCTCAGCTGACGGGCATGAACGTCATGATGTACTACATC
ACCTTCGTCTTCCGAATGGCCGGATACACCGACTCAGCCGGTCTCCTCGCCTCCTCCATCTCCTACATCATCAAC
GTCATCATGACCGTCCCAGCAATCCTCTACGTCGACCGCTGGGGCCGCCGTCCAACTCTCCTCATCGGCTCCCTC
CTCATGGCAACCTGGATGTTCGCCAACGCCGGCATCCTCGCCGCCCACGGCCAAGTCGTCGAGGGAGGCATCGAC
CACGTCAGCTCCCAGTCCATGCTCGTCACGGGAGCGCCGGCAAAGGGCCTCATCGCCTGCACATATCTCTTCGTC
GCCTCCTTCGCTCCCACCTGGGGCCCCGTCTCGTGGATCTACCCGCCTGAGCTGTTCCCGCTGCGTCTCCGTGGC
AAGGGTGTGGCTCTCGCTACTTCGGGTAACTGGGCTTTCAACACGGCTCTCGGCTTCTTCGTGCCTCCCGCTCTC
GCCAATATCAAGTGGAGGACTTACCTCCTCTTCGGCGTCTTCAACATCGCCGCCTTCTTCCACGTCCTCTTCGTC
TTTCCCGAGACGGCTGGAAAGACGCTCGAGGAGACGGAGGCCATGTTCGAGGACCCCAACGGCATCAAGTACCTC
GGCACCCCGGCCTGGAAGACGCGCGTCGTTACCAAGCTCGTCAACCAGGCCGAGCACGGTGAAGTCGACGCCAAA
CGTCAGACTCAGTACCACATGTCTGACGTCCACGACGAGAAGACTGCTCTTTAG
Transcript >Ophun1|2424
ATGCCCATCGGCAACATCTACGTCATTGCCGCCGTCTCCGTTGTGGGCGGCGGCCTGTTCGGCTTCGACATCTCG
TCGCTTTCTGCGCAGTTGGGCGAGCAGGCTTATCTGTGCTACTTTAATCAGGGGCCTTCGGGGCCGCCGTTTAAC
GACGATGAGAAGTGTACGGGGCCGAGGGATGTGGTGCAGGGAGGGATTACGGCGGCCATGGCGGCTGGATCGTGG
CTTGGGGCCTTGGCTTCGGGGCCGTTGAGTGATCGGGCTGGGAGGAGGTATTCCATCATGGTTGGTTGTGTCATC
TGGGTCATCGGCTCCTCCATCATCTGCGCCTCCCAGAGCATCCCCATGCTCGTCGTGGGCCGCCTCATCAACGGC
TTCTGCGTCGGCATCGAATCCGCCCAAGTGCCCGTCTACATCGCCGAAATCTCACCTCCGTCGAAACGCGGCCGC
TTCATCGGCATGCAGCAATGGGCCATCACCTGGGGCATCCTCATCATGTACTACATCTCGTACGGCTGCTCCTTC
ATCGGAGAGCAGAACTCGCGCAACTACCGCGAGGCTGCCTGGCGGATCCCCTGGGGTCTGCAGATGGTGCCGGCC
ATCTTCCTCTTCTTCATGATGATGTTCTTGCCCGAGTCTCCCCGGTGGTTGGCCAGGAAGGGTCGGTGGGATGAG
TGTCGGTCGGTGCTGGCGCTTGTTCATGGTAAGGGGGATGTTGATCATCCGTTTGTTGCCTATGAGATGGACGAC
ATCAAGCAGATGTGCGAGTTTGAGCAGCGTCACTCCAACGTCACGTACCTGGATCTCTTCAAGCCCAACATGATC
CACCGGACCATCATCGGCCTCTTTACTCAGATCTGGTCTCAGCTGACGGGCATGAACGTCATGATGTACTACATC
ACCTTCGTCTTCCGAATGGCCGGATACACCGACTCAGCCGGTCTCCTCGCCTCCTCCATCTCCTACATCATCAAC
GTCATCATGACCGTCCCAGCAATCCTCTACGTCGACCGCTGGGGCCGCCGTCCAACTCTCCTCATCGGCTCCCTC
CTCATGGCAACCTGGATGTTCGCCAACGCCGGCATCCTCGCCGCCCACGGCCAAGTCGTCGAGGGAGGCATCGAC
CACGTCAGCTCCCAGTCCATGCTCGTCACGGGAGCGCCGGCAAAGGGCCTCATCGCCTGCACATATCTCTTCGTC
GCCTCCTTCGCTCCCACCTGGGGCCCCGTCTCGTGGATCTACCCGCCTGAGCTGTTCCCGCTGCGTCTCCGTGGC
AAGGGTGTGGCTCTCGCTACTTCGGGTAACTGGGCTTTCAACACGGCTCTCGGCTTCTTCGTGCCTCCCGCTCTC
GCCAATATCAAGTGGAGGACTTACCTCCTCTTCGGCGTCTTCAACATCGCCGCCTTCTTCCACGTCCTCTTCGTC
TTTCCCGAGACGGCTGGAAAGACGCTCGAGGAGACGGAGGCCATGTTCGAGGACCCCAACGGCATCAAGTACCTC
GGCACCCCGGCCTGGAAGACGCGCGTCGTTACCAAGCTCGTCAACCAGGCCGAGCACGGTGAAGTCGACGCCAAA
CGTCAGACTCAGTACCACATGTCTGACGTCCACGACGAGAAGACTGCTCTTTAG
Gene >Ophun1|2424
ATGCCCATCGGCAACATCTACGTCATTGCCGCCGTCTCCGTTGTGGGCGGCGGCCTGTTCGGCTTCGACATCTCG
TCGCTTTCTGCGCAGTTGGGCGAGCAGGCTTATCTGTGCTACTTTAATCAGGGGCCTTCGGGGCCGCCGTTTAAC
GACGATGAGAAGTGTACGGGGCCGAGGGATGTGGTGCAGGGAGGGATTACGGCGGCCATGGCGGCTGGATCGTGG
CTTGGGGCCTTGGCTTCGGGGCCGTTGAGTGATCGGGCTGGGAGGAGGTATTCCATCATGGTTGGTTGTGTCATC
TGGTGAGCCTTCCATACTTCAGTCCATCTCCTGTCAATGAGATGAGATGAGATGAGATGGAACACATAGACTAAC
ACTCAACCAGGGTCATCGGCTCCTCCATCATCTGCGCCTCCCAGAGCATCCCCATGCTCGTCGTGGGCCGCCTCA
TCAACGGCTTCTGCGTCGGCATCGAATCCGCCCAAGTGCCCGTCTACATCGCCGAAATCTCACCTCCGTCGAAAC
GCGGCCGCTTCATCGGCATGCAGCAATGGGCCATCACCTGGGGCATCCTCATCATGTACTACATCTCGTACGGCT
GCTCCTTCATCGGAGAGCAGAACTCGCGCAACTACCGCGAGGCTGCCTGGCGGATCCCCTGGGGTCTGCAGATGG
TGCCGGCCATCTTCCTCTTCTTCATGATGATGTTCTTGCCCGAGTCTCCCCGGTGGTTGGCCAGGAAGGGTCGGT
GGGATGAGTGTCGGTCGGTGCTGGCGCTTGTTCATGGTAAGGGGGATGTTGATCATCCGTTTGTTGCCTATGAGA
TGGACGACATCAAGCAGATGTGCGAGTTTGAGCAGCGTCACTCCAACGTCACGTACCTGGATCTCTTCAAGCCCA
ACATGATCCACCGGACCATCATCGGCCTCTTTACTCAGATCTGGTCTCAGCTGACGGGCATGAACGTCATGAGTA
TGTCCCGAGAGCATCTCCTCTTCATCTCCTCCTCACCTACCATGTCACAGCTAACAGCATATCCCAGTGTACTAC
ATCACCTTCGTCTTCCGAATGGCCGGATACACCGACTCAGCCGGTCTCCTCGCCTCCTCCATCTCCTACATCATC
AACGTCATCATGACCGTCCCAGCAATCCTCTACGTCGACCGCTGGGGCCGCCGTCCAACTCTCCTCATCGGCTCC
CTCCTCATGGCAACCTGGATGTTCGCCAACGCCGGCATCCTCGCCGCCCACGGCCAAGTCGTCGAGGGAGGCATC
GACCACGTCAGCTCCCAGTCCATGCTCGTCACGGGAGCGCCGGCAAAGGGCCTCATCGCCTGCACATATCTCTTC
GTCGCCTCCTTCGCTCCCACCTGGGGCCCCGTCTCGTGGATCTACCCGCCTGAGCTGTTCCCGCTGCGTCTCCGT
GGCAAGGGTGTGGCTCTCGCTACTTCGGGTAACTGGGCTTTCAACACGGCTCTCGGCTTCTTCGTGCCTCCCGCT
CTCGCCAATATCAAGTGGAGGACTTACCTCCTCTTCGGCGTCTTCAACATCGCCGCCTTCTTCCACGTCCTCTTC
GTCTTTCCCGAGACGGCTGGAAAGACGCTCGAGGAGACGGAGGCCATGTTCGAGGACCCCAACGGCATCAAGTAC
CTCGGCACCCCGGCCTGGAAGACGCGCGTCGTTACCAAGCTCGTCAACCAGGCCGAGCACGGTGAAGTCGACGCC
AAACGTCAGACTCAGTACCACATGTCTGACGTCCACGACGAGAAGACTGCTCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail