Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2419
Gene name
LocationContig_22:21865..23679
Strand+
Gene length (bp)1814
Transcript length (bp)1767
Coding sequence length (bp)1767
Protein length (aa) 589

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13857 Ank_5 Ankyrin repeats (many copies) 8.0E-07 454 500
PF12796 Ank_2 Ankyrin repeats (3 copies) 7.2E-10 417 493
PF13637 Ank_4 Ankyrin repeats (many copies) 1.4E-08 431 483
PF00023 Ank Ankyrin repeat 1.3E-04 462 492

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1LZH7|KANK2_BOVIN KN motif and ankyrin repeat domain-containing protein 2 OS=Bos taurus GN=KANK2 PE=2 SV=1 433 534 6.0E-08
sp|Q5ZJJ9|OSTF1_CHICK Osteoclast-stimulating factor 1 OS=Gallus gallus GN=OSTF1 PE=2 SV=1 414 528 3.0E-07
sp|Q8BXP5|ANR33_MOUSE Ankyrin repeat domain-containing protein 33 OS=Mus musculus GN=Ankrd33 PE=2 SV=1 436 486 4.0E-07
sp|Q14678|KANK1_HUMAN KN motif and ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=KANK1 PE=1 SV=3 433 516 1.0E-06
sp|Q62422|OSTF1_MOUSE Osteoclast-stimulating factor 1 OS=Mus musculus GN=Ostf1 PE=1 SV=2 414 517 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1LZH7|KANK2_BOVIN KN motif and ankyrin repeat domain-containing protein 2 OS=Bos taurus GN=KANK2 PE=2 SV=1 433 534 6.0E-08
sp|Q5ZJJ9|OSTF1_CHICK Osteoclast-stimulating factor 1 OS=Gallus gallus GN=OSTF1 PE=2 SV=1 414 528 3.0E-07
sp|Q8BXP5|ANR33_MOUSE Ankyrin repeat domain-containing protein 33 OS=Mus musculus GN=Ankrd33 PE=2 SV=1 436 486 4.0E-07
sp|Q14678|KANK1_HUMAN KN motif and ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=KANK1 PE=1 SV=3 433 516 1.0E-06
sp|Q62422|OSTF1_MOUSE Osteoclast-stimulating factor 1 OS=Mus musculus GN=Ostf1 PE=1 SV=2 414 517 2.0E-06
sp|Q6P686|OSTF1_RAT Osteoclast-stimulating factor 1 OS=Rattus norvegicus GN=Ostf1 PE=1 SV=1 414 517 2.0E-06
sp|Q8BX02|KANK2_MOUSE KN motif and ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Kank2 PE=1 SV=1 430 533 2.0E-06
sp|Q63ZY3|KANK2_HUMAN KN motif and ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=KANK2 PE=1 SV=1 430 534 2.0E-06
sp|Q92882|OSTF1_HUMAN Osteoclast-stimulating factor 1 OS=Homo sapiens GN=OSTF1 PE=1 SV=2 414 517 3.0E-06
sp|Q8MJ49|OSTF1_PIG Osteoclast-stimulating factor 1 OS=Sus scrofa GN=OSTF1 PE=2 SV=1 414 517 3.0E-06
sp|Q8MJ50|OSTF1_BOVIN Osteoclast-stimulating factor 1 OS=Bos taurus GN=OSTF1 PE=2 SV=1 414 517 3.0E-06
sp|Q6TGW5|OSTF1_DANRE Osteoclast-stimulating factor 1 OS=Danio rerio GN=ostf1 PE=2 SV=1 414 507 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2419
MPDDKSSDLYSILDEAESPIDIRGSGGVAGDVTPPAGQFPNPDSTLEAELKGADELPFAQDLKELATRAEKKAED
DFTDLVDKYKVKLPILRKNNWSLSQLRANFKKLLPSQGIEAMINSWGAGALMAAAIPFYIADVIDVFRKNTTDLE
RAATVTMIVPILGCSLQAASDEEESSLGVASTSLCFIGDVLLFTPLAIIGVFAHMVAPIIRAIELSSSDHVRQLR
DAEWKKHHDKLIHHFKSTEWKTKFLTMHSTQQAVSLFIASEQRGLWKSIQDLSSRVGTPEKDQVEIVMKRQLAAT
QKHMCASLQALNRRMRKALPTQDWVEGQARNFTQEFIKKSEAAGWEAYEEFTSTRWYWSEADEDNHREAYRKKLE
GTSKLLRSTALFAVDPGLIPRAVQAVADEILRLPADCSCLADADQVDKLESAEREEVLFCAASRGYSDVIERLLT
VSNLDVNMQDKNGNTALMLAAAKGHYDLVALLLHRFRAKPTTTNHNNETAQSVAEAASHKPVARLIRSWAPLGVP
CSFWKLGEEMHGHLEWRGGCYCSVTLQEWPALREVMPGASTTGMWVERDRESCMGSEWKADPL*
Coding >Ophun1|2419
ATGCCTGACGATAAGTCGAGCGACTTATACAGCATCCTCGACGAAGCCGAGTCTCCCATCGACATACGCGGTTCA
GGAGGCGTGGCAGGCGACGTAACTCCGCCCGCCGGACAGTTTCCAAATCCCGACTCGACTCTCGAGGCGGAGCTC
AAGGGAGCTGACGAACTGCCCTTTGCACAAGATCTGAAGGAACTGGCTACTCGTGCGGAAAAGAAGGCTGAAGAC
GACTTTACGGACCTGGTCGACAAGTACAAGGTCAAGCTGCCCATCCTCCGCAAGAACAACTGGAGCCTCAGCCAG
CTGCGAGCCAACTTCAAGAAGCTGCTCCCCAGCCAGGGCATCGAAGCCATGATCAACTCGTGGGGCGCAGGGGCG
CTGATGGCGGCGGCCATTCCGTTTTACATCGCCGACGTCATCGACGTCTTCCGCAAGAACACGACCGACTTGGAG
CGGGCGGCGACGGTGACTATGATTGTGCCGATACTGGGATGCTCGTTGCAGGCTGCTTCGGACGAGGAAGAGAGC
TCGCTTGGGGTTGCCAGCACGAGTCTGTGCTTTATAGGCGATGTTCTGCTCTTCACTCCGCTGGCTATAATCGGC
GTCTTTGCCCATATGGTAGCGCCCATTATCAGGGCCATTGAGCTGAGCAGCTCGGACCACGTCCGTCAGCTCCGG
GACGCGGAGTGGAAGAAGCATCACGACAAACTCATCCATCACTTCAAGTCGACGGAGTGGAAGACCAAGTTCCTG
ACGATGCATTCGACGCAGCAGGCCGTAAGTCTGTTTATAGCCTCGGAGCAGAGAGGCCTGTGGAAGTCGATCCAG
GACCTATCCTCTCGAGTCGGAACGCCGGAGAAGGACCAGGTGGAGATTGTCATGAAGAGGCAGTTGGCCGCCACG
CAGAAGCACATGTGTGCCAGCTTACAGGCACTCAATCGAAGGATGCGGAAGGCGTTGCCAACTCAAGACTGGGTT
GAAGGACAGGCGAGGAACTTTACCCAAGAGTTCATCAAGAAGTCGGAAGCCGCGGGCTGGGAGGCGTACGAGGAG
TTTACGAGTACGCGCTGGTATTGGTCCGAGGCTGACGAGGATAACCATCGTGAGGCGTACAGGAAGAAACTCGAG
GGGACGAGCAAGCTCCTCCGGTCGACGGCTCTCTTTGCTGTTGATCCCGGGCTGATACCCCGAGCGGTCCAGGCC
GTGGCCGACGAGATCTTGAGGTTGCCTGCTGACTGTAGCTGTCTAGCTGATGCGGATCAGGTGGACAAGTTGGAG
AGTGCAGAGAGGGAGGAGGTGCTGTTTTGCGCGGCTTCTAGGGGATACTCGGACGTTATTGAACGACTTCTCACC
GTGTCCAACTTGGACGTCAACATGCAAGACAAGAATGGTAACACTGCACTGATGCTGGCAGCAGCAAAGGGCCAT
TACGACCTCGTCGCCCTTCTCCTCCACCGCTTCCGCGCAAAGCCAACAACAACCAACCACAACAACGAGACGGCC
CAGTCAGTGGCCGAAGCCGCATCCCACAAGCCCGTGGCCCGCCTGATCCGAAGCTGGGCTCCGCTCGGCGTCCCG
TGCTCGTTCTGGAAGCTTGGGGAGGAGATGCACGGCCATCTGGAGTGGCGTGGCGGTTGCTATTGCTCTGTTACC
CTCCAGGAGTGGCCGGCGTTGCGGGAGGTTATGCCGGGGGCCTCGACGACGGGGATGTGGGTTGAGCGGGATCGG
GAGAGTTGTATGGGGTCGGAGTGGAAGGCGGATCCGTTATGA
Transcript >Ophun1|2419
ATGCCTGACGATAAGTCGAGCGACTTATACAGCATCCTCGACGAAGCCGAGTCTCCCATCGACATACGCGGTTCA
GGAGGCGTGGCAGGCGACGTAACTCCGCCCGCCGGACAGTTTCCAAATCCCGACTCGACTCTCGAGGCGGAGCTC
AAGGGAGCTGACGAACTGCCCTTTGCACAAGATCTGAAGGAACTGGCTACTCGTGCGGAAAAGAAGGCTGAAGAC
GACTTTACGGACCTGGTCGACAAGTACAAGGTCAAGCTGCCCATCCTCCGCAAGAACAACTGGAGCCTCAGCCAG
CTGCGAGCCAACTTCAAGAAGCTGCTCCCCAGCCAGGGCATCGAAGCCATGATCAACTCGTGGGGCGCAGGGGCG
CTGATGGCGGCGGCCATTCCGTTTTACATCGCCGACGTCATCGACGTCTTCCGCAAGAACACGACCGACTTGGAG
CGGGCGGCGACGGTGACTATGATTGTGCCGATACTGGGATGCTCGTTGCAGGCTGCTTCGGACGAGGAAGAGAGC
TCGCTTGGGGTTGCCAGCACGAGTCTGTGCTTTATAGGCGATGTTCTGCTCTTCACTCCGCTGGCTATAATCGGC
GTCTTTGCCCATATGGTAGCGCCCATTATCAGGGCCATTGAGCTGAGCAGCTCGGACCACGTCCGTCAGCTCCGG
GACGCGGAGTGGAAGAAGCATCACGACAAACTCATCCATCACTTCAAGTCGACGGAGTGGAAGACCAAGTTCCTG
ACGATGCATTCGACGCAGCAGGCCGTAAGTCTGTTTATAGCCTCGGAGCAGAGAGGCCTGTGGAAGTCGATCCAG
GACCTATCCTCTCGAGTCGGAACGCCGGAGAAGGACCAGGTGGAGATTGTCATGAAGAGGCAGTTGGCCGCCACG
CAGAAGCACATGTGTGCCAGCTTACAGGCACTCAATCGAAGGATGCGGAAGGCGTTGCCAACTCAAGACTGGGTT
GAAGGACAGGCGAGGAACTTTACCCAAGAGTTCATCAAGAAGTCGGAAGCCGCGGGCTGGGAGGCGTACGAGGAG
TTTACGAGTACGCGCTGGTATTGGTCCGAGGCTGACGAGGATAACCATCGTGAGGCGTACAGGAAGAAACTCGAG
GGGACGAGCAAGCTCCTCCGGTCGACGGCTCTCTTTGCTGTTGATCCCGGGCTGATACCCCGAGCGGTCCAGGCC
GTGGCCGACGAGATCTTGAGGTTGCCTGCTGACTGTAGCTGTCTAGCTGATGCGGATCAGGTGGACAAGTTGGAG
AGTGCAGAGAGGGAGGAGGTGCTGTTTTGCGCGGCTTCTAGGGGATACTCGGACGTTATTGAACGACTTCTCACC
GTGTCCAACTTGGACGTCAACATGCAAGACAAGAATGGTAACACTGCACTGATGCTGGCAGCAGCAAAGGGCCAT
TACGACCTCGTCGCCCTTCTCCTCCACCGCTTCCGCGCAAAGCCAACAACAACCAACCACAACAACGAGACGGCC
CAGTCAGTGGCCGAAGCCGCATCCCACAAGCCCGTGGCCCGCCTGATCCGAAGCTGGGCTCCGCTCGGCGTCCCG
TGCTCGTTCTGGAAGCTTGGGGAGGAGATGCACGGCCATCTGGAGTGGCGTGGCGGTTGCTATTGCTCTGTTACC
CTCCAGGAGTGGCCGGCGTTGCGGGAGGTTATGCCGGGGGCCTCGACGACGGGGATGTGGGTTGAGCGGGATCGG
GAGAGTTGTATGGGGTCGGAGTGGAAGGCGGATCCGTTATGA
Gene >Ophun1|2419
ATGCCTGACGATAAGTCGAGCGACTTATACAGCATCCTCGACGAAGCCGAGTCTCCCATCGACATACGCGGTTCA
GGAGGCGTGGCAGGCGACGTAACTCCGCCCGCCGGACAGTTTCCAAATCCCGACTCGACTCTCGAGGCGGAGCTC
AAGGGAGCTGACGAACTGCCCTTTGCACAAGATCTGAAGGAACTGGCTACTCGTGCGGAAAAGAAGGCTGAAGAC
GACTTTACGGACCTGGTCGACAAGTACAAGGTCAAGCTGCCCATCCTCCGCAAGAACAACTGGAGCCTCAGCCAG
CTGCGAGCCAACTTCAAGAAGCTGCTCCCCAGCCAGGGCATCGAAGCCATGATCAACTCGTGGGGCGCAGGGGCG
CTGATGGCGGCGGCCATTCCGTTTTACATCGCCGACGTCATCGACGTCTTCCGCAAGAACACGACCGACTTGGAG
CGGGCGGCGACGGTGACTATGATTGTGCCGATACTGGGATGCTCGTTGCAGGCTGCTTCGGACGAGGAAGAGAGC
TCGCTTGGGGTTGCCAGCACGAGTCTGTGCTTTATAGGCGATGTTCTGCTCTTCACTCCGCTGGCTATAATCGGC
GTCTTTGCCCATATGGTAGCGCCCATTATCAGGGCCATTGAGCTGAGCAGCTCGGACCACGTCCGTCAGCTCCGG
GACGCGGAGTGGAAGAAGCATCACGACAAACTCATCCATCACTTCAAGTCGACGGAGTGGAAGACCAAGTTCCTG
ACGATGCATTCGACGCAGCAGGCCGTAAGTCTGTTTATAGCCTCGGAGCAGAGAGGCCTGTGGAAGTCGATCCAG
GACCTATCCTCTCGAGTCGGAACGCCGGAGAAGGACCAGGTGGAGATTGTCATGAAGAGGCAGTTGGCCGCCACG
CAGAAGCACATGTGTGCCAGCTTACAGGCACTCAATCGAAGGATGCGGAAGGCGTTGCCAACTCAAGACTGGGTT
GAAGGACAGGCGAGGAACTTTACCCAAGAGTTCATCAAGAAGTCGGAAGCCGCGGGCTGGGAGGCGTACGAGGAG
TTTACGAGTACGCGCTGGTATTGGTCCGAGGCTGACGAGGATAACCATCGTGAGGCGTACAGGAAGAAACTCGAG
GGGACGAGCAAGCTCCTCCGGTCGACGGCTCTCTTTGCTGTTGATCCCGGGCTGATACCCCGAGCGGTCCAGGCC
GTGGCCGACGAGATCTTGAGGTTGCCTGCTGACTGTAGCTGTCTAGCTGATGCGGATCAGGTGGACAAGTTGGAG
AGTGCAGAGAGGGAGGAGGTGCTGTTTTGCGCGGCTTCTAGGGGATACTCGGACGTTATTGAACGACTTCTCACC
GTGTCCAACTTGGACGTCAACATGCAAGACAAGAATGGTAACACTGCACTGATGCTGGCAGCAGCAAAGGGCCAT
TACGACCTCGTCGCCCTTCTCCTCCACCGCTTCCGCGCAAAGCCAACAACAACCAACCACAACAACGAGACGGCC
CAGTCAGTGGCCGAAGCCGCATCCCACAAGCCCGTGGCCCGCCTGATCCGAAGCTGGGCTCCGCTCGGCGTCCCG
TGCTCGTTCTGGAAGCTTGGGGAGGAGATGCACGGCCATCTGGAGTGGCGTGGCGGTTGCTATTGCTCTGTTACC
CTCCAGGAGTGGCCGGCGTTGCGGGAGGTTATGCCGGGGGCCTCGACGACGGGGATGTGGGTTGAGCGGGATCGG
GAGAGTTGTGTAAGTGGTTTGGTGTCTTGAGGGGGCTTTGCTGACGGGTTGGACAGATGGGGTCGGAGTGGAAGG
CGGATCCGTTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail