Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2419
Gene name
LocationContig_22:21865..23679
Strand+
Gene length (bp)1814
Transcript length (bp)1767
Coding sequence length (bp)1767
Protein length (aa) 589

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13857 Ank_5 Ankyrin repeats (many copies) 8.0E-07 454 500
PF12796 Ank_2 Ankyrin repeats (3 copies) 7.2E-10 417 493
PF13637 Ank_4 Ankyrin repeats (many copies) 1.4E-08 431 483
PF00023 Ank Ankyrin repeat 1.3E-04 462 492

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1LZH7|KANK2_BOVIN KN motif and ankyrin repeat domain-containing protein 2 OS=Bos taurus GN=KANK2 PE=2 SV=1 433 534 6.0E-08
sp|Q5ZJJ9|OSTF1_CHICK Osteoclast-stimulating factor 1 OS=Gallus gallus GN=OSTF1 PE=2 SV=1 414 528 3.0E-07
sp|Q8BXP5|ANR33_MOUSE Ankyrin repeat domain-containing protein 33 OS=Mus musculus GN=Ankrd33 PE=2 SV=1 436 486 4.0E-07
sp|Q14678|KANK1_HUMAN KN motif and ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=KANK1 PE=1 SV=3 433 516 1.0E-06
sp|Q62422|OSTF1_MOUSE Osteoclast-stimulating factor 1 OS=Mus musculus GN=Ostf1 PE=1 SV=2 414 517 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1LZH7|KANK2_BOVIN KN motif and ankyrin repeat domain-containing protein 2 OS=Bos taurus GN=KANK2 PE=2 SV=1 433 534 6.0E-08
sp|Q5ZJJ9|OSTF1_CHICK Osteoclast-stimulating factor 1 OS=Gallus gallus GN=OSTF1 PE=2 SV=1 414 528 3.0E-07
sp|Q8BXP5|ANR33_MOUSE Ankyrin repeat domain-containing protein 33 OS=Mus musculus GN=Ankrd33 PE=2 SV=1 436 486 4.0E-07
sp|Q14678|KANK1_HUMAN KN motif and ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=KANK1 PE=1 SV=3 433 516 1.0E-06
sp|Q62422|OSTF1_MOUSE Osteoclast-stimulating factor 1 OS=Mus musculus GN=Ostf1 PE=1 SV=2 414 517 2.0E-06
sp|Q6P686|OSTF1_RAT Osteoclast-stimulating factor 1 OS=Rattus norvegicus GN=Ostf1 PE=1 SV=1 414 517 2.0E-06
sp|Q8BX02|KANK2_MOUSE KN motif and ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Kank2 PE=1 SV=1 430 533 2.0E-06
sp|Q63ZY3|KANK2_HUMAN KN motif and ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=KANK2 PE=1 SV=1 430 534 2.0E-06
sp|Q92882|OSTF1_HUMAN Osteoclast-stimulating factor 1 OS=Homo sapiens GN=OSTF1 PE=1 SV=2 414 517 3.0E-06
sp|Q8MJ49|OSTF1_PIG Osteoclast-stimulating factor 1 OS=Sus scrofa GN=OSTF1 PE=2 SV=1 414 517 3.0E-06
sp|Q8MJ50|OSTF1_BOVIN Osteoclast-stimulating factor 1 OS=Bos taurus GN=OSTF1 PE=2 SV=1 414 517 3.0E-06
sp|Q6TGW5|OSTF1_DANRE Osteoclast-stimulating factor 1 OS=Danio rerio GN=ostf1 PE=2 SV=1 414 507 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3167
Ophiocordyceps australis 1348a (Ghana) OphauG2|7635
Ophiocordyceps australis map64 (Brazil) OphauB2|4183
Ophiocordyceps australis map64 (Brazil) OphauB2|4293
Ophiocordyceps australis map64 (Brazil) OphauB2|645
Ophiocordyceps camponoti-floridani Ophcf2|05732
Ophiocordyceps camponoti-floridani Ophcf2|07416
Ophiocordyceps camponoti-floridani Ophcf2|06975
Ophiocordyceps camponoti-floridani Ophcf2|06825
Ophiocordyceps camponoti-floridani Ophcf2|06356
Ophiocordyceps camponoti-floridani Ophcf2|06020
Ophiocordyceps camponoti-floridani Ophcf2|04973
Ophiocordyceps camponoti-floridani Ophcf2|03672
Ophiocordyceps camponoti-floridani Ophcf2|03426
Ophiocordyceps camponoti-floridani Ophcf2|02741
Ophiocordyceps camponoti-floridani Ophcf2|02076
Ophiocordyceps camponoti-floridani Ophcf2|01686
Ophiocordyceps camponoti-floridani Ophcf2|01556
Ophiocordyceps camponoti-floridani Ophcf2|00991
Ophiocordyceps camponoti-floridani Ophcf2|00845
Ophiocordyceps camponoti-floridani Ophcf2|00452
Ophiocordyceps camponoti-floridani Ophcf2|00414
Ophiocordyceps camponoti-floridani Ophcf2|00412
Ophiocordyceps camponoti-rufipedis Ophun1|1759
Ophiocordyceps camponoti-rufipedis Ophun1|1629
Ophiocordyceps camponoti-rufipedis Ophun1|1829
Ophiocordyceps camponoti-rufipedis Ophun1|2131
Ophiocordyceps camponoti-rufipedis Ophun1|2141
Ophiocordyceps camponoti-rufipedis Ophun1|2419 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2763
Ophiocordyceps camponoti-rufipedis Ophun1|727
Ophiocordyceps camponoti-rufipedis Ophun1|4236
Ophiocordyceps camponoti-rufipedis Ophun1|6845
Ophiocordyceps camponoti-rufipedis Ophun1|4243
Ophiocordyceps camponoti-rufipedis Ophun1|5577
Ophiocordyceps camponoti-rufipedis Ophun1|1565
Ophiocordyceps camponoti-rufipedis Ophun1|6641
Ophiocordyceps camponoti-rufipedis Ophun1|3654
Ophiocordyceps kimflemingae Ophio5|7949
Ophiocordyceps kimflemingae Ophio5|3591
Ophiocordyceps kimflemingae Ophio5|7259
Ophiocordyceps kimflemingae Ophio5|7113
Ophiocordyceps kimflemingae Ophio5|7005
Ophiocordyceps kimflemingae Ophio5|6824
Ophiocordyceps kimflemingae Ophio5|604
Ophiocordyceps kimflemingae Ophio5|5925
Ophiocordyceps kimflemingae Ophio5|576
Ophiocordyceps kimflemingae Ophio5|5274
Ophiocordyceps kimflemingae Ophio5|4675
Ophiocordyceps kimflemingae Ophio5|3913
Ophiocordyceps kimflemingae Ophio5|2012
Ophiocordyceps kimflemingae Ophio5|1712
Ophiocordyceps kimflemingae Ophio5|7690
Ophiocordyceps subramaniannii Hirsu2|10704
Ophiocordyceps subramaniannii Hirsu2|10673

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2419
MPDDKSSDLYSILDEAESPIDIRGSGGVAGDVTPPAGQFPNPDSTLEAELKGADELPFAQDLKELATRAEKKAED
DFTDLVDKYKVKLPILRKNNWSLSQLRANFKKLLPSQGIEAMINSWGAGALMAAAIPFYIADVIDVFRKNTTDLE
RAATVTMIVPILGCSLQAASDEEESSLGVASTSLCFIGDVLLFTPLAIIGVFAHMVAPIIRAIELSSSDHVRQLR
DAEWKKHHDKLIHHFKSTEWKTKFLTMHSTQQAVSLFIASEQRGLWKSIQDLSSRVGTPEKDQVEIVMKRQLAAT
QKHMCASLQALNRRMRKALPTQDWVEGQARNFTQEFIKKSEAAGWEAYEEFTSTRWYWSEADEDNHREAYRKKLE
GTSKLLRSTALFAVDPGLIPRAVQAVADEILRLPADCSCLADADQVDKLESAEREEVLFCAASRGYSDVIERLLT
VSNLDVNMQDKNGNTALMLAAAKGHYDLVALLLHRFRAKPTTTNHNNETAQSVAEAASHKPVARLIRSWAPLGVP
CSFWKLGEEMHGHLEWRGGCYCSVTLQEWPALREVMPGASTTGMWVERDRESCMGSEWKADPL*
Coding >Ophun1|2419
ATGCCTGACGATAAGTCGAGCGACTTATACAGCATCCTCGACGAAGCCGAGTCTCCCATCGACATACGCGGTTCA
GGAGGCGTGGCAGGCGACGTAACTCCGCCCGCCGGACAGTTTCCAAATCCCGACTCGACTCTCGAGGCGGAGCTC
AAGGGAGCTGACGAACTGCCCTTTGCACAAGATCTGAAGGAACTGGCTACTCGTGCGGAAAAGAAGGCTGAAGAC
GACTTTACGGACCTGGTCGACAAGTACAAGGTCAAGCTGCCCATCCTCCGCAAGAACAACTGGAGCCTCAGCCAG
CTGCGAGCCAACTTCAAGAAGCTGCTCCCCAGCCAGGGCATCGAAGCCATGATCAACTCGTGGGGCGCAGGGGCG
CTGATGGCGGCGGCCATTCCGTTTTACATCGCCGACGTCATCGACGTCTTCCGCAAGAACACGACCGACTTGGAG
CGGGCGGCGACGGTGACTATGATTGTGCCGATACTGGGATGCTCGTTGCAGGCTGCTTCGGACGAGGAAGAGAGC
TCGCTTGGGGTTGCCAGCACGAGTCTGTGCTTTATAGGCGATGTTCTGCTCTTCACTCCGCTGGCTATAATCGGC
GTCTTTGCCCATATGGTAGCGCCCATTATCAGGGCCATTGAGCTGAGCAGCTCGGACCACGTCCGTCAGCTCCGG
GACGCGGAGTGGAAGAAGCATCACGACAAACTCATCCATCACTTCAAGTCGACGGAGTGGAAGACCAAGTTCCTG
ACGATGCATTCGACGCAGCAGGCCGTAAGTCTGTTTATAGCCTCGGAGCAGAGAGGCCTGTGGAAGTCGATCCAG
GACCTATCCTCTCGAGTCGGAACGCCGGAGAAGGACCAGGTGGAGATTGTCATGAAGAGGCAGTTGGCCGCCACG
CAGAAGCACATGTGTGCCAGCTTACAGGCACTCAATCGAAGGATGCGGAAGGCGTTGCCAACTCAAGACTGGGTT
GAAGGACAGGCGAGGAACTTTACCCAAGAGTTCATCAAGAAGTCGGAAGCCGCGGGCTGGGAGGCGTACGAGGAG
TTTACGAGTACGCGCTGGTATTGGTCCGAGGCTGACGAGGATAACCATCGTGAGGCGTACAGGAAGAAACTCGAG
GGGACGAGCAAGCTCCTCCGGTCGACGGCTCTCTTTGCTGTTGATCCCGGGCTGATACCCCGAGCGGTCCAGGCC
GTGGCCGACGAGATCTTGAGGTTGCCTGCTGACTGTAGCTGTCTAGCTGATGCGGATCAGGTGGACAAGTTGGAG
AGTGCAGAGAGGGAGGAGGTGCTGTTTTGCGCGGCTTCTAGGGGATACTCGGACGTTATTGAACGACTTCTCACC
GTGTCCAACTTGGACGTCAACATGCAAGACAAGAATGGTAACACTGCACTGATGCTGGCAGCAGCAAAGGGCCAT
TACGACCTCGTCGCCCTTCTCCTCCACCGCTTCCGCGCAAAGCCAACAACAACCAACCACAACAACGAGACGGCC
CAGTCAGTGGCCGAAGCCGCATCCCACAAGCCCGTGGCCCGCCTGATCCGAAGCTGGGCTCCGCTCGGCGTCCCG
TGCTCGTTCTGGAAGCTTGGGGAGGAGATGCACGGCCATCTGGAGTGGCGTGGCGGTTGCTATTGCTCTGTTACC
CTCCAGGAGTGGCCGGCGTTGCGGGAGGTTATGCCGGGGGCCTCGACGACGGGGATGTGGGTTGAGCGGGATCGG
GAGAGTTGTATGGGGTCGGAGTGGAAGGCGGATCCGTTATGA
Transcript >Ophun1|2419
ATGCCTGACGATAAGTCGAGCGACTTATACAGCATCCTCGACGAAGCCGAGTCTCCCATCGACATACGCGGTTCA
GGAGGCGTGGCAGGCGACGTAACTCCGCCCGCCGGACAGTTTCCAAATCCCGACTCGACTCTCGAGGCGGAGCTC
AAGGGAGCTGACGAACTGCCCTTTGCACAAGATCTGAAGGAACTGGCTACTCGTGCGGAAAAGAAGGCTGAAGAC
GACTTTACGGACCTGGTCGACAAGTACAAGGTCAAGCTGCCCATCCTCCGCAAGAACAACTGGAGCCTCAGCCAG
CTGCGAGCCAACTTCAAGAAGCTGCTCCCCAGCCAGGGCATCGAAGCCATGATCAACTCGTGGGGCGCAGGGGCG
CTGATGGCGGCGGCCATTCCGTTTTACATCGCCGACGTCATCGACGTCTTCCGCAAGAACACGACCGACTTGGAG
CGGGCGGCGACGGTGACTATGATTGTGCCGATACTGGGATGCTCGTTGCAGGCTGCTTCGGACGAGGAAGAGAGC
TCGCTTGGGGTTGCCAGCACGAGTCTGTGCTTTATAGGCGATGTTCTGCTCTTCACTCCGCTGGCTATAATCGGC
GTCTTTGCCCATATGGTAGCGCCCATTATCAGGGCCATTGAGCTGAGCAGCTCGGACCACGTCCGTCAGCTCCGG
GACGCGGAGTGGAAGAAGCATCACGACAAACTCATCCATCACTTCAAGTCGACGGAGTGGAAGACCAAGTTCCTG
ACGATGCATTCGACGCAGCAGGCCGTAAGTCTGTTTATAGCCTCGGAGCAGAGAGGCCTGTGGAAGTCGATCCAG
GACCTATCCTCTCGAGTCGGAACGCCGGAGAAGGACCAGGTGGAGATTGTCATGAAGAGGCAGTTGGCCGCCACG
CAGAAGCACATGTGTGCCAGCTTACAGGCACTCAATCGAAGGATGCGGAAGGCGTTGCCAACTCAAGACTGGGTT
GAAGGACAGGCGAGGAACTTTACCCAAGAGTTCATCAAGAAGTCGGAAGCCGCGGGCTGGGAGGCGTACGAGGAG
TTTACGAGTACGCGCTGGTATTGGTCCGAGGCTGACGAGGATAACCATCGTGAGGCGTACAGGAAGAAACTCGAG
GGGACGAGCAAGCTCCTCCGGTCGACGGCTCTCTTTGCTGTTGATCCCGGGCTGATACCCCGAGCGGTCCAGGCC
GTGGCCGACGAGATCTTGAGGTTGCCTGCTGACTGTAGCTGTCTAGCTGATGCGGATCAGGTGGACAAGTTGGAG
AGTGCAGAGAGGGAGGAGGTGCTGTTTTGCGCGGCTTCTAGGGGATACTCGGACGTTATTGAACGACTTCTCACC
GTGTCCAACTTGGACGTCAACATGCAAGACAAGAATGGTAACACTGCACTGATGCTGGCAGCAGCAAAGGGCCAT
TACGACCTCGTCGCCCTTCTCCTCCACCGCTTCCGCGCAAAGCCAACAACAACCAACCACAACAACGAGACGGCC
CAGTCAGTGGCCGAAGCCGCATCCCACAAGCCCGTGGCCCGCCTGATCCGAAGCTGGGCTCCGCTCGGCGTCCCG
TGCTCGTTCTGGAAGCTTGGGGAGGAGATGCACGGCCATCTGGAGTGGCGTGGCGGTTGCTATTGCTCTGTTACC
CTCCAGGAGTGGCCGGCGTTGCGGGAGGTTATGCCGGGGGCCTCGACGACGGGGATGTGGGTTGAGCGGGATCGG
GAGAGTTGTATGGGGTCGGAGTGGAAGGCGGATCCGTTATGA
Gene >Ophun1|2419
ATGCCTGACGATAAGTCGAGCGACTTATACAGCATCCTCGACGAAGCCGAGTCTCCCATCGACATACGCGGTTCA
GGAGGCGTGGCAGGCGACGTAACTCCGCCCGCCGGACAGTTTCCAAATCCCGACTCGACTCTCGAGGCGGAGCTC
AAGGGAGCTGACGAACTGCCCTTTGCACAAGATCTGAAGGAACTGGCTACTCGTGCGGAAAAGAAGGCTGAAGAC
GACTTTACGGACCTGGTCGACAAGTACAAGGTCAAGCTGCCCATCCTCCGCAAGAACAACTGGAGCCTCAGCCAG
CTGCGAGCCAACTTCAAGAAGCTGCTCCCCAGCCAGGGCATCGAAGCCATGATCAACTCGTGGGGCGCAGGGGCG
CTGATGGCGGCGGCCATTCCGTTTTACATCGCCGACGTCATCGACGTCTTCCGCAAGAACACGACCGACTTGGAG
CGGGCGGCGACGGTGACTATGATTGTGCCGATACTGGGATGCTCGTTGCAGGCTGCTTCGGACGAGGAAGAGAGC
TCGCTTGGGGTTGCCAGCACGAGTCTGTGCTTTATAGGCGATGTTCTGCTCTTCACTCCGCTGGCTATAATCGGC
GTCTTTGCCCATATGGTAGCGCCCATTATCAGGGCCATTGAGCTGAGCAGCTCGGACCACGTCCGTCAGCTCCGG
GACGCGGAGTGGAAGAAGCATCACGACAAACTCATCCATCACTTCAAGTCGACGGAGTGGAAGACCAAGTTCCTG
ACGATGCATTCGACGCAGCAGGCCGTAAGTCTGTTTATAGCCTCGGAGCAGAGAGGCCTGTGGAAGTCGATCCAG
GACCTATCCTCTCGAGTCGGAACGCCGGAGAAGGACCAGGTGGAGATTGTCATGAAGAGGCAGTTGGCCGCCACG
CAGAAGCACATGTGTGCCAGCTTACAGGCACTCAATCGAAGGATGCGGAAGGCGTTGCCAACTCAAGACTGGGTT
GAAGGACAGGCGAGGAACTTTACCCAAGAGTTCATCAAGAAGTCGGAAGCCGCGGGCTGGGAGGCGTACGAGGAG
TTTACGAGTACGCGCTGGTATTGGTCCGAGGCTGACGAGGATAACCATCGTGAGGCGTACAGGAAGAAACTCGAG
GGGACGAGCAAGCTCCTCCGGTCGACGGCTCTCTTTGCTGTTGATCCCGGGCTGATACCCCGAGCGGTCCAGGCC
GTGGCCGACGAGATCTTGAGGTTGCCTGCTGACTGTAGCTGTCTAGCTGATGCGGATCAGGTGGACAAGTTGGAG
AGTGCAGAGAGGGAGGAGGTGCTGTTTTGCGCGGCTTCTAGGGGATACTCGGACGTTATTGAACGACTTCTCACC
GTGTCCAACTTGGACGTCAACATGCAAGACAAGAATGGTAACACTGCACTGATGCTGGCAGCAGCAAAGGGCCAT
TACGACCTCGTCGCCCTTCTCCTCCACCGCTTCCGCGCAAAGCCAACAACAACCAACCACAACAACGAGACGGCC
CAGTCAGTGGCCGAAGCCGCATCCCACAAGCCCGTGGCCCGCCTGATCCGAAGCTGGGCTCCGCTCGGCGTCCCG
TGCTCGTTCTGGAAGCTTGGGGAGGAGATGCACGGCCATCTGGAGTGGCGTGGCGGTTGCTATTGCTCTGTTACC
CTCCAGGAGTGGCCGGCGTTGCGGGAGGTTATGCCGGGGGCCTCGACGACGGGGATGTGGGTTGAGCGGGATCGG
GAGAGTTGTGTAAGTGGTTTGGTGTCTTGAGGGGGCTTTGCTGACGGGTTGGACAGATGGGGTCGGAGTGGAAGG
CGGATCCGTTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail