Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2415
Gene name
LocationContig_22:8128..11035
Strand+
Gene length (bp)2907
Transcript length (bp)2907
Coding sequence length (bp)2907
Protein length (aa) 969

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WQG9|ACRB_ASPFU Probable ubiquitination network signaling protein acrB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=acrB PE=3 SV=1 1 851 6.0E-74
sp|B0Y4N5|ACRB_ASPFC Probable ubiquitination network signaling protein acrB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=acrB PE=3 SV=1 1 851 7.0E-73
sp|A1CW63|ACRB_NEOFI Probable ubiquitination network signaling protein acrB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=acrB PE=3 SV=1 163 851 2.0E-72
sp|Q876Q0|ACRB_EMENI Ubiquitination network signaling protein acrB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acrB PE=3 SV=1 137 851 8.0E-70
sp|Q0CT23|ACRB_ASPTN Probable ubiquitination network signaling protein acrB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=acrB PE=3 SV=1 163 847 5.0E-69
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WQG9|ACRB_ASPFU Probable ubiquitination network signaling protein acrB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=acrB PE=3 SV=1 1 851 6.0E-74
sp|B0Y4N5|ACRB_ASPFC Probable ubiquitination network signaling protein acrB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=acrB PE=3 SV=1 1 851 7.0E-73
sp|A1CW63|ACRB_NEOFI Probable ubiquitination network signaling protein acrB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=acrB PE=3 SV=1 163 851 2.0E-72
sp|Q876Q0|ACRB_EMENI Ubiquitination network signaling protein acrB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acrB PE=3 SV=1 137 851 8.0E-70
sp|Q0CT23|ACRB_ASPTN Probable ubiquitination network signaling protein acrB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=acrB PE=3 SV=1 163 847 5.0E-69
sp|A1CIK0|ACRB_ASPCL Probable ubiquitination network signaling protein acrB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=acrB PE=3 SV=1 163 849 2.0E-68
sp|Q2UUI0|ACRB_ASPOR Probable ubiquitination network signaling protein acrB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=acrB PE=3 SV=2 163 851 4.0E-68
sp|A2Q9L8|ACRB_ASPNC Probable ubiquitination network signaling protein acrB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=acrB PE=3 SV=2 1 844 3.0E-67
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 189 211 22
2 232 254 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2415
MPRASSSGKRQLGAGVGHREARHDHGLVGPGRRISAATRGCGYLNVCSDSYASVSQPSPPSPPSPSPPPPPPPPP
TLLPPPSLAANGLVNGGHVKRRADDAHVPPGLDLRPGHALRRRSLDDAYSETSSESCLSSLGPGPDGGHRHIDVN
AMKNADVHRDSGPLDLAVSVVRSLPIQDTLAILIILMHLPYLSLTLVYACFASLTFVPPVANRAGWNINFGEIFD
GNSHTPSLATVVCMDFFFFLIWVFLWPPIQDSILEFAKPVIAVTLGGGTSAKDGTSQGVTACFAWVLLHKLVRAS
RRYWPRLAHHLPDAWRVRAVLGGSLPTATATTTMSSTTTAAALHAPYDKRDTHGWIQSVLAIHILSQGIVRYIRE
WYLRRERFHAVAGPGDPEAAKSPSAVAGASTSSLAGSADAAHDAGLNTPEAETTPLASSPHPAGLMKKRRKQSAQ
VRLQQPLWAALASTKIVAMKEIELSTWAGGSSDKRDIHNAGTAPSFDRQPRQIWISYIGSDEVCFSTSHFPDEAD
DESCKANGARPAGVDTTKPFYVRINNAFWQPTRIFPVGGDGAGALGWTGDIYGLRPASKYVCEFVHLQTDQVLFT
TSIRTVKEPLRDRDVSSPGQADGEQPLRQDSPATTLRTSIEASEIKLLEERNKLKSFRKDAKARINALKKDNELT
ENQLASAGGNDERFRQKIRQQETQKAQTERDLCNLSEQIKLLDEARPELSERKKQAERAFSAEKRVYDAAQKQLK
EHRSQLAKDVKAKEAEKANLIARRNKTATRIAKIDNELASISNSNNRGKGEVERRRQERNRWLEQAAAAEQGYSE
RLAQLVAANQRKREHVRELQAQLDSIFMKPPANGIPMEGATPSFRRTSPWNSSPMANNYPWTPDVRTASMTARMP
PPTGFDSRGARARVRSSSMLSDVSGFTQASDDGSASAPVGTRPRARPSTAATLRNGSSGSSSSVGEAN*
Coding >Ophun1|2415
ATGCCTCGGGCATCGAGCTCGGGCAAGCGACAGCTGGGCGCCGGCGTCGGCCACCGCGAGGCGAGGCACGATCAT
GGGCTCGTAGGCCCTGGAAGGCGCATCTCGGCCGCTACAAGGGGCTGCGGCTACCTCAACGTCTGCTCTGACAGC
TATGCCTCTGTTTCTCAGCCGTCGCCTCCCTCGCCGCCCTCGCCCTCGCCGCCTCCGCCGCCTCCGCCGCCGCCG
ACGCTGCTGCCGCCACCTTCGCTTGCCGCCAACGGTCTTGTCAACGGCGGCCATGTCAAGAGACGTGCTGACGAT
GCCCACGTCCCGCCAGGCCTTGATCTTCGACCAGGTCATGCTCTCCGCAGGCGTTCGCTCGACGACGCCTACTCA
GAGACTTCGTCCGAGTCGTGTCTCTCAAGCCTGGGCCCTGGCCCCGACGGTGGTCATCGCCACATCGACGTCAAT
GCAATGAAGAACGCCGACGTTCACCGTGACTCGGGGCCCCTGGACCTCGCTGTCAGCGTCGTCCGCTCTTTGCCC
ATCCAGGATACGCTCGCCATACTCATCATTCTTATGCACCTCCCCTACCTCTCCCTGACGCTGGTCTATGCCTGC
TTCGCCTCCCTCACATTCGTTCCTCCCGTCGCCAACAGGGCCGGTTGGAACATCAACTTTGGCGAAATATTCGAC
GGCAACTCGCATACGCCTTCGCTCGCCACCGTCGTCTGCATGGATTTCTTCTTCTTCCTCATCTGGGTCTTTCTC
TGGCCGCCCATACAGGACTCGATTCTCGAGTTCGCCAAGCCCGTCATTGCCGTCACCCTCGGAGGCGGCACCAGC
GCCAAGGACGGCACATCGCAAGGCGTCACCGCTTGCTTCGCCTGGGTCCTGCTTCACAAGCTCGTCCGCGCCTCG
AGGCGCTACTGGCCTCGTCTAGCCCACCACTTACCCGATGCGTGGCGCGTGCGGGCCGTCCTAGGCGGTTCCTTG
CCGACGGCGACGGCTACGACGACCATGTCTTCGACGACTACTGCCGCCGCTCTTCACGCGCCGTACGATAAGAGA
GACACGCACGGGTGGATTCAGAGCGTCCTCGCCATCCACATACTTAGTCAAGGTATCGTCAGGTATATTCGCGAA
TGGTACCTTCGCCGCGAACGCTTCCATGCCGTGGCCGGTCCGGGTGATCCGGAGGCGGCCAAATCGCCTTCGGCC
GTTGCCGGCGCGAGCACGTCTAGCCTCGCGGGTTCTGCCGACGCCGCTCACGACGCGGGGCTAAACACGCCCGAG
GCCGAGACGACCCCCCTCGCTTCCTCGCCTCACCCGGCCGGCTTGATGAAGAAGCGGCGAAAGCAGAGCGCTCAG
GTGCGTCTGCAGCAGCCGCTATGGGCGGCGCTCGCCAGCACCAAGATCGTGGCCATGAAGGAGATTGAGCTCTCC
ACCTGGGCGGGGGGCAGTTCCGACAAGCGAGACATCCACAACGCCGGGACTGCACCGTCTTTCGACCGGCAGCCG
AGGCAGATCTGGATCTCCTATATCGGTAGCGACGAGGTCTGCTTCAGCACCAGTCACTTCCCGGACGAGGCCGAC
GACGAGTCTTGCAAGGCCAACGGCGCCAGACCCGCCGGCGTGGACACGACCAAGCCCTTTTACGTCAGGATTAAC
AACGCCTTCTGGCAGCCCACGCGCATCTTCCCCGTCGGCGGAGACGGTGCTGGCGCGCTCGGATGGACGGGCGAC
ATCTACGGCCTGCGTCCCGCGTCCAAGTACGTGTGCGAATTCGTGCACCTTCAGACGGACCAGGTCCTGTTCACG
ACGAGCATCCGCACGGTTAAGGAACCCCTGCGCGATCGAGACGTGTCGTCGCCCGGCCAGGCCGACGGGGAGCAG
CCGTTGCGCCAAGACTCGCCCGCAACCACGCTCCGGACCTCGATCGAGGCGTCTGAGATTAAGCTTCTGGAGGAA
AGGAACAAGCTCAAGTCGTTTCGCAAGGACGCAAAGGCCCGCATCAACGCGCTGAAGAAGGACAACGAGCTCACT
GAGAATCAGCTCGCTTCGGCGGGTGGCAACGACGAGCGCTTCAGGCAAAAGATCCGGCAGCAGGAGACGCAAAAG
GCACAGACGGAGCGCGACCTGTGCAACCTGTCGGAGCAGATCAAGCTGTTGGATGAGGCCAGGCCCGAGCTTTCG
GAGCGTAAGAAGCAGGCGGAACGGGCTTTTTCGGCCGAAAAGAGGGTGTACGACGCGGCACAGAAGCAGCTTAAG
GAGCACAGATCTCAGCTCGCTAAGGACGTCAAGGCCAAGGAGGCGGAGAAGGCGAACTTGATTGCTCGACGCAAT
AAGACCGCAACACGCATCGCCAAGATCGATAACGAGCTCGCAAGTATCAGCAACTCCAACAACCGCGGCAAGGGC
GAGGTGGAGCGCCGGCGTCAGGAGAGGAACAGATGGCTGGAGCAGGCGGCGGCGGCTGAGCAAGGCTACTCGGAG
CGACTGGCGCAGCTGGTGGCCGCCAACCAGAGAAAGAGGGAGCACGTCCGCGAGCTGCAGGCGCAGCTGGACTCG
ATCTTCATGAAGCCGCCGGCCAACGGGATCCCTATGGAGGGCGCTACTCCGTCCTTCCGGCGGACGAGCCCGTGG
AATTCGAGTCCGATGGCTAACAACTACCCCTGGACCCCGGACGTGCGGACGGCCAGCATGACGGCGCGGATGCCT
CCTCCGACGGGCTTCGACAGTCGCGGCGCAAGGGCTCGGGTTAGGAGCTCGAGCATGCTTAGTGACGTGAGCGGC
TTCACGCAGGCCAGCGACGACGGCTCAGCGTCGGCCCCGGTCGGGACACGGCCGCGGGCTCGACCGTCGACAGCG
GCGACTCTGAGGAACGGGAGCAGCGGTAGCAGTAGCAGCGTGGGCGAGGCCAATTGA
Transcript >Ophun1|2415
ATGCCTCGGGCATCGAGCTCGGGCAAGCGACAGCTGGGCGCCGGCGTCGGCCACCGCGAGGCGAGGCACGATCAT
GGGCTCGTAGGCCCTGGAAGGCGCATCTCGGCCGCTACAAGGGGCTGCGGCTACCTCAACGTCTGCTCTGACAGC
TATGCCTCTGTTTCTCAGCCGTCGCCTCCCTCGCCGCCCTCGCCCTCGCCGCCTCCGCCGCCTCCGCCGCCGCCG
ACGCTGCTGCCGCCACCTTCGCTTGCCGCCAACGGTCTTGTCAACGGCGGCCATGTCAAGAGACGTGCTGACGAT
GCCCACGTCCCGCCAGGCCTTGATCTTCGACCAGGTCATGCTCTCCGCAGGCGTTCGCTCGACGACGCCTACTCA
GAGACTTCGTCCGAGTCGTGTCTCTCAAGCCTGGGCCCTGGCCCCGACGGTGGTCATCGCCACATCGACGTCAAT
GCAATGAAGAACGCCGACGTTCACCGTGACTCGGGGCCCCTGGACCTCGCTGTCAGCGTCGTCCGCTCTTTGCCC
ATCCAGGATACGCTCGCCATACTCATCATTCTTATGCACCTCCCCTACCTCTCCCTGACGCTGGTCTATGCCTGC
TTCGCCTCCCTCACATTCGTTCCTCCCGTCGCCAACAGGGCCGGTTGGAACATCAACTTTGGCGAAATATTCGAC
GGCAACTCGCATACGCCTTCGCTCGCCACCGTCGTCTGCATGGATTTCTTCTTCTTCCTCATCTGGGTCTTTCTC
TGGCCGCCCATACAGGACTCGATTCTCGAGTTCGCCAAGCCCGTCATTGCCGTCACCCTCGGAGGCGGCACCAGC
GCCAAGGACGGCACATCGCAAGGCGTCACCGCTTGCTTCGCCTGGGTCCTGCTTCACAAGCTCGTCCGCGCCTCG
AGGCGCTACTGGCCTCGTCTAGCCCACCACTTACCCGATGCGTGGCGCGTGCGGGCCGTCCTAGGCGGTTCCTTG
CCGACGGCGACGGCTACGACGACCATGTCTTCGACGACTACTGCCGCCGCTCTTCACGCGCCGTACGATAAGAGA
GACACGCACGGGTGGATTCAGAGCGTCCTCGCCATCCACATACTTAGTCAAGGTATCGTCAGGTATATTCGCGAA
TGGTACCTTCGCCGCGAACGCTTCCATGCCGTGGCCGGTCCGGGTGATCCGGAGGCGGCCAAATCGCCTTCGGCC
GTTGCCGGCGCGAGCACGTCTAGCCTCGCGGGTTCTGCCGACGCCGCTCACGACGCGGGGCTAAACACGCCCGAG
GCCGAGACGACCCCCCTCGCTTCCTCGCCTCACCCGGCCGGCTTGATGAAGAAGCGGCGAAAGCAGAGCGCTCAG
GTGCGTCTGCAGCAGCCGCTATGGGCGGCGCTCGCCAGCACCAAGATCGTGGCCATGAAGGAGATTGAGCTCTCC
ACCTGGGCGGGGGGCAGTTCCGACAAGCGAGACATCCACAACGCCGGGACTGCACCGTCTTTCGACCGGCAGCCG
AGGCAGATCTGGATCTCCTATATCGGTAGCGACGAGGTCTGCTTCAGCACCAGTCACTTCCCGGACGAGGCCGAC
GACGAGTCTTGCAAGGCCAACGGCGCCAGACCCGCCGGCGTGGACACGACCAAGCCCTTTTACGTCAGGATTAAC
AACGCCTTCTGGCAGCCCACGCGCATCTTCCCCGTCGGCGGAGACGGTGCTGGCGCGCTCGGATGGACGGGCGAC
ATCTACGGCCTGCGTCCCGCGTCCAAGTACGTGTGCGAATTCGTGCACCTTCAGACGGACCAGGTCCTGTTCACG
ACGAGCATCCGCACGGTTAAGGAACCCCTGCGCGATCGAGACGTGTCGTCGCCCGGCCAGGCCGACGGGGAGCAG
CCGTTGCGCCAAGACTCGCCCGCAACCACGCTCCGGACCTCGATCGAGGCGTCTGAGATTAAGCTTCTGGAGGAA
AGGAACAAGCTCAAGTCGTTTCGCAAGGACGCAAAGGCCCGCATCAACGCGCTGAAGAAGGACAACGAGCTCACT
GAGAATCAGCTCGCTTCGGCGGGTGGCAACGACGAGCGCTTCAGGCAAAAGATCCGGCAGCAGGAGACGCAAAAG
GCACAGACGGAGCGCGACCTGTGCAACCTGTCGGAGCAGATCAAGCTGTTGGATGAGGCCAGGCCCGAGCTTTCG
GAGCGTAAGAAGCAGGCGGAACGGGCTTTTTCGGCCGAAAAGAGGGTGTACGACGCGGCACAGAAGCAGCTTAAG
GAGCACAGATCTCAGCTCGCTAAGGACGTCAAGGCCAAGGAGGCGGAGAAGGCGAACTTGATTGCTCGACGCAAT
AAGACCGCAACACGCATCGCCAAGATCGATAACGAGCTCGCAAGTATCAGCAACTCCAACAACCGCGGCAAGGGC
GAGGTGGAGCGCCGGCGTCAGGAGAGGAACAGATGGCTGGAGCAGGCGGCGGCGGCTGAGCAAGGCTACTCGGAG
CGACTGGCGCAGCTGGTGGCCGCCAACCAGAGAAAGAGGGAGCACGTCCGCGAGCTGCAGGCGCAGCTGGACTCG
ATCTTCATGAAGCCGCCGGCCAACGGGATCCCTATGGAGGGCGCTACTCCGTCCTTCCGGCGGACGAGCCCGTGG
AATTCGAGTCCGATGGCTAACAACTACCCCTGGACCCCGGACGTGCGGACGGCCAGCATGACGGCGCGGATGCCT
CCTCCGACGGGCTTCGACAGTCGCGGCGCAAGGGCTCGGGTTAGGAGCTCGAGCATGCTTAGTGACGTGAGCGGC
TTCACGCAGGCCAGCGACGACGGCTCAGCGTCGGCCCCGGTCGGGACACGGCCGCGGGCTCGACCGTCGACAGCG
GCGACTCTGAGGAACGGGAGCAGCGGTAGCAGTAGCAGCGTGGGCGAGGCCAATTGA
Gene >Ophun1|2415
ATGCCTCGGGCATCGAGCTCGGGCAAGCGACAGCTGGGCGCCGGCGTCGGCCACCGCGAGGCGAGGCACGATCAT
GGGCTCGTAGGCCCTGGAAGGCGCATCTCGGCCGCTACAAGGGGCTGCGGCTACCTCAACGTCTGCTCTGACAGC
TATGCCTCTGTTTCTCAGCCGTCGCCTCCCTCGCCGCCCTCGCCCTCGCCGCCTCCGCCGCCTCCGCCGCCGCCG
ACGCTGCTGCCGCCACCTTCGCTTGCCGCCAACGGTCTTGTCAACGGCGGCCATGTCAAGAGACGTGCTGACGAT
GCCCACGTCCCGCCAGGCCTTGATCTTCGACCAGGTCATGCTCTCCGCAGGCGTTCGCTCGACGACGCCTACTCA
GAGACTTCGTCCGAGTCGTGTCTCTCAAGCCTGGGCCCTGGCCCCGACGGTGGTCATCGCCACATCGACGTCAAT
GCAATGAAGAACGCCGACGTTCACCGTGACTCGGGGCCCCTGGACCTCGCTGTCAGCGTCGTCCGCTCTTTGCCC
ATCCAGGATACGCTCGCCATACTCATCATTCTTATGCACCTCCCCTACCTCTCCCTGACGCTGGTCTATGCCTGC
TTCGCCTCCCTCACATTCGTTCCTCCCGTCGCCAACAGGGCCGGTTGGAACATCAACTTTGGCGAAATATTCGAC
GGCAACTCGCATACGCCTTCGCTCGCCACCGTCGTCTGCATGGATTTCTTCTTCTTCCTCATCTGGGTCTTTCTC
TGGCCGCCCATACAGGACTCGATTCTCGAGTTCGCCAAGCCCGTCATTGCCGTCACCCTCGGAGGCGGCACCAGC
GCCAAGGACGGCACATCGCAAGGCGTCACCGCTTGCTTCGCCTGGGTCCTGCTTCACAAGCTCGTCCGCGCCTCG
AGGCGCTACTGGCCTCGTCTAGCCCACCACTTACCCGATGCGTGGCGCGTGCGGGCCGTCCTAGGCGGTTCCTTG
CCGACGGCGACGGCTACGACGACCATGTCTTCGACGACTACTGCCGCCGCTCTTCACGCGCCGTACGATAAGAGA
GACACGCACGGGTGGATTCAGAGCGTCCTCGCCATCCACATACTTAGTCAAGGTATCGTCAGGTATATTCGCGAA
TGGTACCTTCGCCGCGAACGCTTCCATGCCGTGGCCGGTCCGGGTGATCCGGAGGCGGCCAAATCGCCTTCGGCC
GTTGCCGGCGCGAGCACGTCTAGCCTCGCGGGTTCTGCCGACGCCGCTCACGACGCGGGGCTAAACACGCCCGAG
GCCGAGACGACCCCCCTCGCTTCCTCGCCTCACCCGGCCGGCTTGATGAAGAAGCGGCGAAAGCAGAGCGCTCAG
GTGCGTCTGCAGCAGCCGCTATGGGCGGCGCTCGCCAGCACCAAGATCGTGGCCATGAAGGAGATTGAGCTCTCC
ACCTGGGCGGGGGGCAGTTCCGACAAGCGAGACATCCACAACGCCGGGACTGCACCGTCTTTCGACCGGCAGCCG
AGGCAGATCTGGATCTCCTATATCGGTAGCGACGAGGTCTGCTTCAGCACCAGTCACTTCCCGGACGAGGCCGAC
GACGAGTCTTGCAAGGCCAACGGCGCCAGACCCGCCGGCGTGGACACGACCAAGCCCTTTTACGTCAGGATTAAC
AACGCCTTCTGGCAGCCCACGCGCATCTTCCCCGTCGGCGGAGACGGTGCTGGCGCGCTCGGATGGACGGGCGAC
ATCTACGGCCTGCGTCCCGCGTCCAAGTACGTGTGCGAATTCGTGCACCTTCAGACGGACCAGGTCCTGTTCACG
ACGAGCATCCGCACGGTTAAGGAACCCCTGCGCGATCGAGACGTGTCGTCGCCCGGCCAGGCCGACGGGGAGCAG
CCGTTGCGCCAAGACTCGCCCGCAACCACGCTCCGGACCTCGATCGAGGCGTCTGAGATTAAGCTTCTGGAGGAA
AGGAACAAGCTCAAGTCGTTTCGCAAGGACGCAAAGGCCCGCATCAACGCGCTGAAGAAGGACAACGAGCTCACT
GAGAATCAGCTCGCTTCGGCGGGTGGCAACGACGAGCGCTTCAGGCAAAAGATCCGGCAGCAGGAGACGCAAAAG
GCACAGACGGAGCGCGACCTGTGCAACCTGTCGGAGCAGATCAAGCTGTTGGATGAGGCCAGGCCCGAGCTTTCG
GAGCGTAAGAAGCAGGCGGAACGGGCTTTTTCGGCCGAAAAGAGGGTGTACGACGCGGCACAGAAGCAGCTTAAG
GAGCACAGATCTCAGCTCGCTAAGGACGTCAAGGCCAAGGAGGCGGAGAAGGCGAACTTGATTGCTCGACGCAAT
AAGACCGCAACACGCATCGCCAAGATCGATAACGAGCTCGCAAGTATCAGCAACTCCAACAACCGCGGCAAGGGC
GAGGTGGAGCGCCGGCGTCAGGAGAGGAACAGATGGCTGGAGCAGGCGGCGGCGGCTGAGCAAGGCTACTCGGAG
CGACTGGCGCAGCTGGTGGCCGCCAACCAGAGAAAGAGGGAGCACGTCCGCGAGCTGCAGGCGCAGCTGGACTCG
ATCTTCATGAAGCCGCCGGCCAACGGGATCCCTATGGAGGGCGCTACTCCGTCCTTCCGGCGGACGAGCCCGTGG
AATTCGAGTCCGATGGCTAACAACTACCCCTGGACCCCGGACGTGCGGACGGCCAGCATGACGGCGCGGATGCCT
CCTCCGACGGGCTTCGACAGTCGCGGCGCAAGGGCTCGGGTTAGGAGCTCGAGCATGCTTAGTGACGTGAGCGGC
TTCACGCAGGCCAGCGACGACGGCTCAGCGTCGGCCCCGGTCGGGACACGGCCGCGGGCTCGACCGTCGACAGCG
GCGACTCTGAGGAACGGGAGCAGCGGTAGCAGTAGCAGCGTGGGCGAGGCCAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail