Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2410
Gene name
LocationContig_2193:34..988
Strand-
Gene length (bp)954
Transcript length (bp)780
Coding sequence length (bp)780
Protein length (aa) 260

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase 1.7E-10 101 232

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZR25|5GT_VERHY Anthocyanidin 3-O-glucoside 5-O-glucosyltransferase OS=Verbena hybrida GN=HGT8 PE=2 SV=1 32 226 8.0E-11
sp|Q9LR44|U75B1_ARATH UDP-glycosyltransferase 75B1 OS=Arabidopsis thaliana GN=UGT75B1 PE=1 SV=1 43 226 3.0E-10
sp|O23406|U75D1_ARATH UDP-glycosyltransferase 75D1 OS=Arabidopsis thaliana GN=UGT75D1 PE=2 SV=2 43 226 6.0E-09
sp|F8WKW0|UGT1_GARJA Crocetin glucosyltransferase, chloroplastic OS=Gardenia jasminoides GN=UGT75L6 PE=1 SV=1 43 226 1.0E-08
sp|O22182|U84B1_ARATH UDP-glycosyltransferase 84B1 OS=Arabidopsis thaliana GN=UGT84B1 PE=2 SV=1 86 237 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZR25|5GT_VERHY Anthocyanidin 3-O-glucoside 5-O-glucosyltransferase OS=Verbena hybrida GN=HGT8 PE=2 SV=1 32 226 8.0E-11
sp|Q9LR44|U75B1_ARATH UDP-glycosyltransferase 75B1 OS=Arabidopsis thaliana GN=UGT75B1 PE=1 SV=1 43 226 3.0E-10
sp|O23406|U75D1_ARATH UDP-glycosyltransferase 75D1 OS=Arabidopsis thaliana GN=UGT75D1 PE=2 SV=2 43 226 6.0E-09
sp|F8WKW0|UGT1_GARJA Crocetin glucosyltransferase, chloroplastic OS=Gardenia jasminoides GN=UGT75L6 PE=1 SV=1 43 226 1.0E-08
sp|O22182|U84B1_ARATH UDP-glycosyltransferase 84B1 OS=Arabidopsis thaliana GN=UGT84B1 PE=2 SV=1 86 237 3.0E-08
sp|Q6VAA6|U74G1_STERE UDP-glycosyltransferase 74G1 OS=Stevia rebaudiana GN=UGT74G1 PE=1 SV=1 91 231 4.0E-08
sp|Q9LVF0|U84A2_ARATH UDP-glycosyltransferase 84A2 OS=Arabidopsis thaliana GN=UGT84A2 PE=1 SV=1 25 217 4.0E-08
sp|Q9SKC1|U74C1_ARATH UDP-glycosyltransferase 74C1 OS=Arabidopsis thaliana GN=UGT74C1 PE=2 SV=1 86 226 4.0E-08
sp|Q9LSY9|U71B1_ARATH UDP-glycosyltransferase 71B1 OS=Arabidopsis thaliana GN=UGT71B1 PE=2 SV=1 68 231 2.0E-07
sp|Q9ZVY5|U75B2_ARATH UDP-glycosyltransferase 75B2 OS=Arabidopsis thaliana GN=UGT75B2 PE=2 SV=1 49 226 2.0E-07
sp|Q9MB73|LGT_CITUN Limonoid UDP-glucosyltransferase OS=Citrus unshiu PE=2 SV=1 24 217 2.0E-07
sp|Q41819|IABG_MAIZE Indole-3-acetate beta-glucosyltransferase OS=Zea mays GN=IAGLU PE=1 SV=1 95 227 3.0E-07
sp|Q9ZR26|5GT2_PERFR Anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 2 OS=Perilla frutescens GN=PF3R6 PE=2 SV=1 43 226 4.0E-07
sp|O22183|U84B2_ARATH UDP-glycosyltransferase 84B2 OS=Arabidopsis thaliana GN=UGT84B2 PE=3 SV=1 95 235 5.0E-07
sp|Q9ZR27|5GT1_PERFR Anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 1 OS=Perilla frutescens GN=PF3R4 PE=1 SV=1 43 226 9.0E-07
sp|Q9SYK9|U74E2_ARATH UDP-glycosyltransferase 74E2 OS=Arabidopsis thaliana GN=UGT74E2 PE=1 SV=1 91 217 9.0E-07
sp|Q2V6K1|UGT_FRAAN Putative UDP-glucose glucosyltransferase OS=Fragaria ananassa GN=GT5 PE=2 SV=1 95 231 3.0E-06
sp|Q9LSY6|U71B6_ARATH UDP-glycosyltransferase 71B6 OS=Arabidopsis thaliana GN=UGT71B6 PE=1 SV=1 55 231 3.0E-06
sp|Q767C8|IH5GT_IRIHO Cyanidin 3-O-rutinoside 5-O-glucosyltransferase OS=Iris hollandica GN=5GT PE=1 SV=1 67 226 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008194 UDP-glycosyltransferase activity Yes
GO:0016757 glycosyltransferase activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2410
MELLTDVSFTAIYTVVLYVADANRRAVVAHLQKQLGAKLVTAIEAYLGDDKPKTLVGSHPELDYPGLVPPHIIAC
GPIMRTAAAVAESDPELGAWLARGPTVYVNLGSLYSIDEEQALEMARALAVVLGEGGRQVLWKLKRMGEYGVGEA
GDGVFDALAGVIGDERVRVVVDWLEAEPLSILASGHVVCSVHHGGANSFYEAVVTGVPQVVLPQWTDTYDYAERV
ELLGIGRLGNRSTMPRWTGGRVGGAVPGAGVRGG*
Coding >Ophun1|2410
ATGGAGTTGCTGACCGACGTTTCTTTCACTGCAATCTACACGGTCGTGCTGTACGTGGCCGACGCCAACCGAAGA
GCCGTCGTCGCCCACCTACAGAAGCAGCTGGGAGCCAAGCTGGTGACGGCGATAGAAGCCTACCTCGGCGACGAC
AAGCCCAAGACGCTGGTGGGCTCTCACCCGGAACTCGACTACCCGGGCCTGGTGCCTCCTCACATCATCGCCTGC
GGGCCCATCATGCGGACGGCGGCGGCGGTGGCGGAGTCGGATCCGGAGCTGGGGGCGTGGTTGGCGAGGGGGCCG
ACCGTCTATGTGAACCTGGGGTCGTTGTACTCTATCGACGAGGAGCAGGCGTTGGAGATGGCGCGCGCGTTGGCG
GTTGTCCTTGGGGAGGGGGGGAGGCAGGTGCTTTGGAAGCTGAAGCGGATGGGTGAGTATGGTGTTGGAGAGGCT
GGGGATGGGGTGTTTGATGCGTTGGCTGGGGTGATTGGGGACGAGCGCGTGAGGGTTGTTGTTGACTGGTTGGAG
GCTGAGCCGCTGTCTATCCTCGCGTCCGGACACGTCGTCTGCTCGGTTCACCACGGAGGCGCCAATTCGTTTTAC
GAGGCCGTCGTAACCGGCGTGCCGCAGGTCGTTCTCCCGCAGTGGACCGACACGTACGACTACGCCGAGCGCGTC
GAGCTGCTGGGCATCGGCCGTCTGGGGAACCGGTCGACGATGCCGCGCTGGACGGGCGGCCGGGTTGGCGGAGCT
GTGCCGGGAGCGGGGGTCCGGGGCGGATAA
Transcript >Ophun1|2410
ATGGAGTTGCTGACCGACGTTTCTTTCACTGCAATCTACACGGTCGTGCTGTACGTGGCCGACGCCAACCGAAGA
GCCGTCGTCGCCCACCTACAGAAGCAGCTGGGAGCCAAGCTGGTGACGGCGATAGAAGCCTACCTCGGCGACGAC
AAGCCCAAGACGCTGGTGGGCTCTCACCCGGAACTCGACTACCCGGGCCTGGTGCCTCCTCACATCATCGCCTGC
GGGCCCATCATGCGGACGGCGGCGGCGGTGGCGGAGTCGGATCCGGAGCTGGGGGCGTGGTTGGCGAGGGGGCCG
ACCGTCTATGTGAACCTGGGGTCGTTGTACTCTATCGACGAGGAGCAGGCGTTGGAGATGGCGCGCGCGTTGGCG
GTTGTCCTTGGGGAGGGGGGGAGGCAGGTGCTTTGGAAGCTGAAGCGGATGGGTGAGTATGGTGTTGGAGAGGCT
GGGGATGGGGTGTTTGATGCGTTGGCTGGGGTGATTGGGGACGAGCGCGTGAGGGTTGTTGTTGACTGGTTGGAG
GCTGAGCCGCTGTCTATCCTCGCGTCCGGACACGTCGTCTGCTCGGTTCACCACGGAGGCGCCAATTCGTTTTAC
GAGGCCGTCGTAACCGGCGTGCCGCAGGTCGTTCTCCCGCAGTGGACCGACACGTACGACTACGCCGAGCGCGTC
GAGCTGCTGGGCATCGGCCGTCTGGGGAACCGGTCGACGATGCCGCGCTGGACGGGCGGCCGGGTTGGCGGAGCT
GTGCCGGGAGCGGGGGTCCGGGGCGGATAA
Gene >Ophun1|2410
ATGGAGTTGCTGACCGACGTTTCTTTCACTGCAGTCTCTTTTCAGGATACCGCTACCCCGTGCCGTGGTACTCGT
CGCCGCTCAACACCTTTTACAAGATCTACACGGTCGTGCTGTACGTGGCCGACGCCAACCGAAGAGCCGTCGTCG
CCCACCTACAGAAGCAGCTGGGAGCCAAGCTGGTGACGGCGATAGAAGCCTACCTCGGCGACGACAAGCCCAAGA
CGCTGGTGGGCTCTCACCCGGAACTCGACTACCCGGGCCTGGTGCCTCCTCACATCATCGCCTGCGGGCCCATCA
TGCGGACGGCGGCGGCGGTGGCGGAGTCGGATCCGGAGCTGGGGGCGTGGTTGGCGAGGGGGCCGACCGTCTATG
TGAACCTGGGGTCGTTGTACTCTATCGACGAGGAGCAGGCGTTGGAGATGGCGCGCGCGTTGGCGGTTGTCCTTG
GGGAGGGGGGGAGGCAGGTGCTTTGGAAGCTGAAGCGGATGGGTGAGTATGGTGTTGGAGAGGCTGGGGATGGGG
TGTTTGATGCGTTGGCTGGGGTGATTGGGGACGAGCGCGTGAGGGTTGTTGTTGACTGGTTGGAGGCTGAGCCGC
TGTCTATCCTCGCGTCCGGACACGTCGTCTGCTCGGTTCACCACGGAGGCGCCAATTCGTTTTACGAGGCCGTCG
TGTAAGTCACAACAGCTGGAAACAAAGAGCTGACTGACCGGTGACAAACAGAACCGGCGTGCCGCAGGTCGTTCT
CCCGCAGTGGACCGACACGTACGACTACGCCGAGCGCGTCGAGCTGCTGGGCATCGGCCGTCTGGGGAACCGGTC
GACGATGCCGCGCTGGACGGTGGCGGAGCTGGCGGAGGCGCTGTCTGACGTCTTGTCCGATGGGGCGGTGCTTCG
GAGGGCGGCCGGGTTGGCGGAGCTGTGCCGGGAGCGGGGGTCCGGGGCGGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail