Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|241
Gene name
LocationContig_1052:1437..3810
Strand-
Gene length (bp)2373
Transcript length (bp)2160
Coding sequence length (bp)2160
Protein length (aa) 720

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 2.6E-41 52 541
PF07690 MFS_1 Major Facilitator Superfamily 4.8E-20 107 483

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RVX9|PHO5_NEUCR Repressible high-affinity phosphate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pho-5 PE=1 SV=2 1 544 0.0E+00
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 7 542 1.0E-169
sp|O48639|PHT13_ARATH Probable inorganic phosphate transporter 1-3 OS=Arabidopsis thaliana GN=PHT1-3 PE=2 SV=1 35 544 3.0E-93
sp|Q494P0|PHT17_ARATH Probable inorganic phosphate transporter 1-7 OS=Arabidopsis thaliana GN=PHT1-7 PE=2 SV=2 35 544 4.0E-93
sp|Q8VYM2|PHT11_ARATH Inorganic phosphate transporter 1-1 OS=Arabidopsis thaliana GN=PHT1-1 PE=1 SV=2 35 550 6.0E-93
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RVX9|PHO5_NEUCR Repressible high-affinity phosphate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pho-5 PE=1 SV=2 1 544 0.0E+00
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 7 542 1.0E-169
sp|O48639|PHT13_ARATH Probable inorganic phosphate transporter 1-3 OS=Arabidopsis thaliana GN=PHT1-3 PE=2 SV=1 35 544 3.0E-93
sp|Q494P0|PHT17_ARATH Probable inorganic phosphate transporter 1-7 OS=Arabidopsis thaliana GN=PHT1-7 PE=2 SV=2 35 544 4.0E-93
sp|Q8VYM2|PHT11_ARATH Inorganic phosphate transporter 1-1 OS=Arabidopsis thaliana GN=PHT1-1 PE=1 SV=2 35 550 6.0E-93
sp|Q8H6H0|PHT16_ORYSJ Inorganic phosphate transporter 1-6 OS=Oryza sativa subsp. japonica GN=PHT1-6 PE=1 SV=1 35 551 9.0E-93
sp|Q9ZWT3|PHT16_ARATH Probable inorganic phosphate transporter 1-6 OS=Arabidopsis thaliana GN=PHT1-6 PE=1 SV=1 35 544 2.0E-91
sp|Q8GSD9|PHT12_ORYSJ Inorganic phosphate transporter 1-2 OS=Oryza sativa subsp. japonica GN=PTH1-2 PE=2 SV=1 35 544 3.0E-91
sp|Q7XDZ7|PHT13_ORYSJ Probable inorganic phosphate transporter 1-3 OS=Oryza sativa subsp. japonica GN=PHT1-3 PE=2 SV=1 35 544 5.0E-91
sp|Q8GYF4|PHT15_ARATH Probable inorganic phosphate transporter 1-5 OS=Arabidopsis thaliana GN=PHT1-5 PE=2 SV=2 30 544 3.0E-90
sp|Q7X7V2|PHT15_ORYSJ Probable inorganic phosphate transporter 1-5 OS=Oryza sativa subsp. japonica GN=PHT1-5 PE=2 SV=2 29 544 5.0E-90
sp|Q96303|PHT14_ARATH Inorganic phosphate transporter 1-4 OS=Arabidopsis thaliana GN=PHT1-4 PE=1 SV=1 30 543 1.0E-89
sp|Q8H6H2|PHT14_ORYSJ Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. japonica GN=PHT1-4 PE=2 SV=1 35 544 2.0E-89
sp|Q01MW8|PHT14_ORYSI Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. indica GN=PHT1-4 PE=2 SV=2 35 544 2.0E-89
sp|Q8H6G9|PHT17_ORYSJ Probable inorganic phosphate transporter 1-7 OS=Oryza sativa subsp. japonica GN=PHT1-7 PE=2 SV=1 35 544 7.0E-88
sp|Q8H6G8|PHT18_ORYSJ Probable inorganic phosphate transporter 1-8 OS=Oryza sativa subsp. japonica GN=PHT1-8 PE=2 SV=1 35 544 6.0E-86
sp|Q8H074|PT112_ORYSJ Probable inorganic phosphate transporter 1-12 OS=Oryza sativa subsp. japonica GN=PHT1-12 PE=2 SV=1 35 555 8.0E-86
sp|Q9P6J9|YHD1_SCHPO Putative inorganic phosphate transporter C1683.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.01 PE=3 SV=1 49 541 1.0E-85
sp|Q96243|PHT12_ARATH Probable inorganic phosphate transporter 1-2 OS=Arabidopsis thaliana GN=PHT1-2 PE=2 SV=2 35 550 2.0E-85
sp|O42885|YBN1_SCHPO Putative inorganic phosphate transporter C8E4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.01c PE=1 SV=2 47 569 2.0E-85
sp|Q8H6H4|PHT11_ORYSJ Inorganic phosphate transporter 1-1 OS=Oryza sativa subsp. japonica GN=PHT1-1 PE=2 SV=1 35 544 3.0E-84
sp|Q09852|YAEC_SCHPO Putative inorganic phosphate transporter C23D3.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23D3.12 PE=1 SV=1 22 544 2.0E-83
sp|Q94DB8|PT111_ORYSJ Inorganic phosphate transporter 1-11 OS=Oryza sativa subsp. japonica GN=PHT1-11 PE=2 SV=1 35 544 4.0E-83
sp|Q9Y7Q9|YCX2_SCHPO Probable metabolite transporter C2H8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC2H8.02 PE=1 SV=1 47 533 2.0E-82
sp|Q9SYQ1|PHT18_ARATH Probable inorganic phosphate transporter 1-8 OS=Arabidopsis thaliana GN=PHT1-8 PE=2 SV=2 35 540 4.0E-82
sp|Q7XRH8|PT113_ORYSJ Putative inorganic phosphate transporter 1-13 OS=Oryza sativa subsp. japonica GN=PHT1-13 PE=3 SV=2 34 543 5.0E-81
sp|Q69T94|PT110_ORYSJ Probable inorganic phosphate transporter 1-10 OS=Oryza sativa subsp. japonica GN=PHT1-10 PE=2 SV=1 35 565 3.0E-79
sp|Q9S735|PHT19_ARATH Probable inorganic phosphate transporter 1-9 OS=Arabidopsis thaliana GN=PHT1-9 PE=2 SV=1 35 544 1.0E-78
sp|Q8H6G7|PHT19_ORYSJ Probable inorganic phosphate transporter 1-9 OS=Oryza sativa subsp. japonica GN=PHT1-9 PE=2 SV=2 27 556 2.0E-75
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 104 542 2.0E-23
sp|O94342|YHM9_SCHPO Probable metabolite transport protein C1271.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.09 PE=3 SV=1 47 572 2.0E-17
sp|O34691|NAIP_BACSU Putative niacin/nicotinamide transporter NaiP OS=Bacillus subtilis (strain 168) GN=naiP PE=1 SV=1 53 481 2.0E-15
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 37 541 1.0E-14
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 26 535 5.0E-14
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 99 542 1.0E-13
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 115 566 2.0E-13
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 77 544 2.0E-13
sp|Q4U2R8|S22A6_HUMAN Solute carrier family 22 member 6 OS=Homo sapiens GN=SLC22A6 PE=1 SV=1 111 612 3.0E-12
sp|Q4W8A3|S22A6_MACFA Solute carrier family 22 member 6 OS=Macaca fascicularis GN=SLC22A6 PE=1 SV=1 111 488 8.0E-12
sp|A6QLW8|S22A7_BOVIN Solute carrier family 22 member 7 OS=Bos taurus GN=SLC22A7 PE=2 SV=1 98 488 1.0E-11
sp|Q6A4L0|S22AD_MOUSE Solute carrier family 22 member 13 OS=Mus musculus GN=Slc22a13 PE=1 SV=3 110 540 2.0E-11
sp|Q91WU2|S22A7_MOUSE Solute carrier family 22 member 7 OS=Mus musculus GN=Slc22a7 PE=1 SV=1 99 488 2.0E-11
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 101 542 3.0E-11
sp|Q5RCH6|S22A6_PONAB Solute carrier family 22 member 6 OS=Pongo abelii GN=SLC22A6 PE=2 SV=1 111 488 4.0E-11
sp|Q9TSY7|S22A6_RABIT Solute carrier family 22 member 6 OS=Oryctolagus cuniculus GN=SLC22A6 PE=2 SV=1 110 488 4.0E-11
sp|Q8MK48|S22A6_PIG Solute carrier family 22 member 6 OS=Sus scrofa GN=SLC22A6 PE=1 SV=2 111 488 4.0E-11
sp|O35956|S22A6_RAT Solute carrier family 22 member 6 OS=Rattus norvegicus GN=Slc22a6 PE=1 SV=1 110 488 6.0E-11
sp|Q8VC69|S22A6_MOUSE Solute carrier family 22 member 6 OS=Mus musculus GN=Slc22a6 PE=1 SV=1 111 488 1.0E-10
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 98 542 1.0E-10
sp|Q46909|YGCS_ECOLI Inner membrane metabolite transport protein YgcS OS=Escherichia coli (strain K12) GN=ygcS PE=1 SV=2 106 483 2.0E-10
sp|Q1RPP5|S22A7_PIG Solute carrier family 22 member 7 OS=Sus scrofa GN=SLC22A7 PE=2 SV=1 98 488 3.0E-10
sp|Q9Y694|S22A7_HUMAN Solute carrier family 22 member 7 OS=Homo sapiens GN=SLC22A7 PE=1 SV=1 98 488 4.0E-10
sp|Q5RLM2|S22A7_RAT Solute carrier family 22 member 7 OS=Rattus norvegicus GN=Slc22a7 PE=1 SV=1 99 477 8.0E-10
sp|Q5R540|S22A7_PONAB Solute carrier family 22 member 7 OS=Pongo abelii GN=SLC22A7 PE=2 SV=1 98 488 9.0E-10
sp|Q864Z3|S22A6_BOVIN Solute carrier family 22 member 6 OS=Bos taurus GN=SLC22A6 PE=2 SV=2 111 488 1.0E-09
sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens GN=SLC2A9 PE=1 SV=2 111 542 2.0E-09
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 46 285 3.0E-09
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 96 542 8.0E-09
sp|Q66J52|S226B_XENLA Solute carrier family 22 member 6-B OS=Xenopus laevis GN=slc22a6-b PE=2 SV=1 102 544 9.0E-09
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 110 541 1.0E-08
sp|Q6NYN7|S22A6_DANRE Solute carrier family 22 member 6 OS=Danio rerio GN=slc22a6 PE=2 SV=1 111 483 1.0E-08
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 96 542 1.0E-08
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 96 542 1.0E-08
sp|Q5RB09|GTR9_PONAB Solute carrier family 2, facilitated glucose transporter member 9 OS=Pongo abelii GN=SLC2A9 PE=2 SV=1 111 542 1.0E-08
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 111 542 2.0E-08
sp|Q04162|YD387_YEAST Probable metabolite transport protein YDR387C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR387C PE=1 SV=1 36 302 2.0E-08
sp|P25346|GIT1_YEAST Probable metabolite transport protein GIT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIT1 PE=1 SV=1 104 497 3.0E-08
sp|P0C0L7|PROP_ECOLI Proline/betaine transporter OS=Escherichia coli (strain K12) GN=proP PE=1 SV=1 49 465 3.0E-08
sp|P0C0L8|PROP_ECO57 Proline/betaine transporter OS=Escherichia coli O157:H7 GN=proP PE=3 SV=1 49 465 3.0E-08
sp|Q80UJ1|S22AK_MOUSE Solute carrier family 22 member 20 OS=Mus musculus GN=Slc22a20 PE=1 SV=1 110 501 4.0E-08
sp|O04249|STP7_ARATH Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1 101 542 5.0E-08
sp|P40862|PROP_SALTY Proline/betaine transporter OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=proP PE=3 SV=2 49 439 5.0E-08
sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 111 313 5.0E-08
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 109 567 5.0E-08
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 110 475 5.0E-08
sp|Q6PDF3|SVOPL_MOUSE Putative transporter SVOPL OS=Mus musculus GN=Svopl PE=2 SV=1 111 541 6.0E-08
sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 111 313 6.0E-08
sp|Q66KG0|S22AG_XENLA Solute carrier family 22 member 16 OS=Xenopus laevis GN=slc22a16 PE=2 SV=2 111 483 1.0E-07
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 104 542 1.0E-07
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 109 570 1.0E-07
sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=1 SV=1 111 313 1.0E-07
sp|Q9JIS5|SV2A_MOUSE Synaptic vesicle glycoprotein 2A OS=Mus musculus GN=Sv2a PE=1 SV=1 96 349 2.0E-07
sp|Q02563|SV2A_RAT Synaptic vesicle glycoprotein 2A OS=Rattus norvegicus GN=Sv2a PE=1 SV=2 96 349 2.0E-07
sp|Q8N434|SVOPL_HUMAN Putative transporter SVOPL OS=Homo sapiens GN=SVOPL PE=2 SV=2 111 541 2.0E-07
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 34 486 2.0E-07
sp|Q9VCA2|ORCT_DROME Organic cation transporter protein OS=Drosophila melanogaster GN=Orct PE=1 SV=1 111 488 2.0E-07
sp|Q29397|SV2A_BOVIN Synaptic vesicle glycoprotein 2A OS=Bos taurus GN=SV2A PE=2 SV=1 96 349 3.0E-07
sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 96 280 3.0E-07
sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1 96 280 4.0E-07
sp|Q5R4L9|SV2A_PONAB Synaptic vesicle glycoprotein 2A OS=Pongo abelii GN=SV2A PE=2 SV=1 96 280 4.0E-07
sp|Q3YAW7|S22A7_RABIT Solute carrier family 22 member 7 OS=Oryctolagus cuniculus GN=SLC22A7 PE=2 SV=1 111 488 4.0E-07
sp|Q8IZD6|S22AF_HUMAN Solute carrier family 22 member 15 OS=Homo sapiens GN=SLC22A15 PE=2 SV=1 110 492 5.0E-07
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 96 542 7.0E-07
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 100 542 9.0E-07
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 100 542 9.0E-07
sp|Q93Y91|STP5_ARATH Sugar transport protein 5 OS=Arabidopsis thaliana GN=STP5 PE=2 SV=1 159 475 1.0E-06
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 246 542 1.0E-06
sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 96 542 1.0E-06
sp|Q9LHQ6|OCT4_ARATH Organic cation/carnitine transporter 4 OS=Arabidopsis thaliana GN=OCT4 PE=2 SV=1 110 483 1.0E-06
sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus GN=Slc2a2 PE=1 SV=3 120 544 2.0E-06
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 85 542 3.0E-06
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 114 542 3.0E-06
sp|Q9LNV3|STP2_ARATH Sugar transport protein 2 OS=Arabidopsis thaliana GN=STP2 PE=1 SV=3 130 542 3.0E-06
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucose transporter member 5 OS=Bos taurus GN=SLC2A5 PE=1 SV=2 114 542 4.0E-06
sp|Q39228|STP4_ARATH Sugar transport protein 4 OS=Arabidopsis thaliana GN=STP4 PE=1 SV=1 159 542 5.0E-06
sp|O44827|FGT1_CAEEL Facilitated glucose transporter protein 1 OS=Caenorhabditis elegans GN=fgt-1 PE=1 SV=2 109 544 5.0E-06
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 121 289 5.0E-06
sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 96 542 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.5

Transmembrane Domains

Domain # Start End Length
1 43 60 17
2 65 83 18
3 106 123 17
4 136 158 22
5 194 216 22
6 245 267 22
7 341 363 22
8 376 398 22
9 408 426 18
10 433 455 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|241
MGTPTRTYGGNRAFHNFYNDYSHIPDPNLRRRLALSEIDKVPLGLYHVRAIMVAGVGFLLDSYDIFAINLVTVLL
GMVFWGGARREDGYGGNGGVLPDGTNQALKGATSAGIIVGMVVFGWLADTMGRRRMYGIDLAIIILATFSCALAS
ASPAMGPSALLIAWRVLMGIGIGGDYPLSSVITSEFAPTRWRGAMIAAVFSMQGVGLLMSALVALVTTVAFKPSF
IDIVDETHCDANCQAAADRCWRIIVGVGAVPACLAMYYRITIPETPRYTFDVQHDVEKADADIQAYVQSKTQRAA
GKRFSTTLLTVPRASWADLAAYFSHWAHLRVLIGTTMSWFFLDLAFYGLGLNSTIVLGAIGYGKGRNLYEKLYNQ
AVGIIILACAGSLPGYLFAVLTIDTIGRKPLQVTGFLLLTVIFCILGFSLSRLSEGAMLALYVIGQFLFSAGPNT
TTFVVPGECFPTRYRATGHGLSAAMGKMGAVVAQVMSIPLLKPGSDDACTTGDQCAAKLDRLMQLFALFMLLGTV
SSLLIPETKGLTLEELSGEPSTSYNAGCNGSINHDTNTPSRRWNPFRGGHPAGFYYPRSHAATLFGKTRRRSPRT
DIMVPFQPDAPDTVFPSPSSTPSRGRRRRQYQEHHHLRRLIWRRESRNPRRDGSVESNEMTLRGCTPRSDPDHDA
GRKPDEVPEWGAGWGRIDRGGPSPAGSSMQLQDVGMLLGGESTY*
Coding >Ophun1|241
ATGGGCACTCCAACCCGCACCTACGGCGGCAACCGAGCCTTCCACAACTTCTACAACGACTACTCGCATATCCCC
GACCCCAACCTCCGCCGCCGTCTGGCCCTCTCGGAGATTGACAAGGTGCCCCTCGGACTCTACCATGTGCGAGCC
ATCATGGTGGCGGGCGTTGGCTTCCTGCTCGACTCATACGACATCTTCGCCATTAACCTCGTTACCGTCCTGCTG
GGCATGGTCTTTTGGGGCGGGGCTCGACGTGAGGATGGCTATGGTGGGAACGGGGGTGTTTTACCGGATGGGACG
AACCAGGCGCTCAAGGGGGCTACGAGCGCGGGCATCATCGTTGGTATGGTGGTGTTTGGCTGGCTGGCAGACACC
ATGGGCCGTCGAAGGATGTACGGAATCGACCTCGCCATCATCATCCTAGCTACCTTTAGCTGCGCCCTCGCCTCA
GCCAGTCCAGCCATGGGTCCTTCAGCACTACTCATCGCCTGGAGAGTCCTGATGGGCATCGGGATAGGAGGAGAC
TATCCCCTCTCTTCCGTCATAACCTCCGAATTCGCCCCAACCCGCTGGCGAGGCGCCATGATCGCCGCCGTCTTC
TCCATGCAAGGCGTAGGCCTCCTCATGTCCGCCCTCGTCGCCCTCGTCACCACCGTCGCCTTCAAACCCTCCTTC
ATCGACATCGTCGACGAAACCCACTGTGATGCAAACTGTCAGGCTGCCGCAGACCGCTGCTGGCGTATCATCGTG
GGCGTAGGTGCCGTTCCAGCCTGTCTGGCCATGTACTACCGCATCACCATCCCCGAGACGCCGCGGTATACCTTT
GACGTCCAGCATGATGTCGAAAAGGCCGATGCCGATATCCAGGCCTATGTTCAGAGCAAGACGCAGAGGGCTGCT
GGCAAAAGGTTCTCTACCACGCTGCTGACGGTTCCGAGGGCGTCGTGGGCCGATCTGGCTGCCTACTTCAGTCAT
TGGGCTCATCTACGGGTGCTGATAGGCACCACCATGTCTTGGTTCTTCCTCGACCTCGCCTTCTACGGCCTCGGA
CTCAACAGCACCATCGTCCTCGGCGCCATCGGTTACGGTAAAGGCCGCAACTTGTACGAAAAGCTATACAACCAA
GCCGTCGGCATCATCATCCTCGCCTGCGCCGGCTCTCTTCCCGGCTATCTCTTCGCCGTCCTAACCATCGACACC
ATCGGCCGCAAGCCGCTCCAAGTCACCGGCTTCCTGCTCCTCACCGTCATCTTCTGCATCCTCGGCTTCAGCCTC
AGCCGACTGAGCGAAGGCGCCATGCTGGCCCTCTACGTCATCGGCCAGTTTCTCTTCAGCGCAGGACCAAACACC
ACCACCTTTGTCGTGCCCGGAGAATGCTTCCCAACCCGCTATCGAGCTACGGGCCACGGCCTGTCAGCAGCCATG
GGCAAGATGGGCGCCGTCGTGGCCCAGGTCATGAGTATCCCGCTGCTCAAGCCGGGTTCTGATGACGCCTGTACC
ACTGGAGACCAGTGTGCAGCCAAGCTGGACCGTCTGATGCAGCTGTTTGCCCTCTTCATGTTGCTCGGCACCGTG
TCATCGCTCCTCATCCCTGAGACGAAAGGCCTGACACTCGAGGAGTTATCCGGAGAGCCCAGCACGAGCTACAAC
GCCGGCTGCAACGGGAGCATCAACCACGATACAAACACTCCCTCCCGACGCTGGAATCCCTTCCGAGGCGGCCAT
CCAGCAGGCTTCTACTACCCACGCTCCCACGCCGCAACTCTCTTCGGCAAAACCCGCCGCCGGTCACCACGAACA
GACATCATGGTCCCCTTCCAGCCGGACGCCCCGGACACAGTCTTCCCCTCCCCGTCATCAACGCCCAGCCGAGGC
CGCAGACGACGACAGTATCAGGAGCATCACCACCTACGACGTCTCATCTGGCGGCGCGAAAGCCGCAACCCGCGC
CGCGACGGAAGCGTCGAGTCCAATGAGATGACGCTTCGGGGCTGCACGCCGAGATCGGACCCGGATCATGACGCG
GGACGGAAGCCGGATGAGGTGCCGGAGTGGGGCGCCGGATGGGGCCGGATCGACCGGGGTGGACCGTCGCCGGCG
GGGAGCAGCATGCAGCTACAGGACGTGGGGATGCTGCTGGGAGGAGAGTCTACGTACTGA
Transcript >Ophun1|241
ATGGGCACTCCAACCCGCACCTACGGCGGCAACCGAGCCTTCCACAACTTCTACAACGACTACTCGCATATCCCC
GACCCCAACCTCCGCCGCCGTCTGGCCCTCTCGGAGATTGACAAGGTGCCCCTCGGACTCTACCATGTGCGAGCC
ATCATGGTGGCGGGCGTTGGCTTCCTGCTCGACTCATACGACATCTTCGCCATTAACCTCGTTACCGTCCTGCTG
GGCATGGTCTTTTGGGGCGGGGCTCGACGTGAGGATGGCTATGGTGGGAACGGGGGTGTTTTACCGGATGGGACG
AACCAGGCGCTCAAGGGGGCTACGAGCGCGGGCATCATCGTTGGTATGGTGGTGTTTGGCTGGCTGGCAGACACC
ATGGGCCGTCGAAGGATGTACGGAATCGACCTCGCCATCATCATCCTAGCTACCTTTAGCTGCGCCCTCGCCTCA
GCCAGTCCAGCCATGGGTCCTTCAGCACTACTCATCGCCTGGAGAGTCCTGATGGGCATCGGGATAGGAGGAGAC
TATCCCCTCTCTTCCGTCATAACCTCCGAATTCGCCCCAACCCGCTGGCGAGGCGCCATGATCGCCGCCGTCTTC
TCCATGCAAGGCGTAGGCCTCCTCATGTCCGCCCTCGTCGCCCTCGTCACCACCGTCGCCTTCAAACCCTCCTTC
ATCGACATCGTCGACGAAACCCACTGTGATGCAAACTGTCAGGCTGCCGCAGACCGCTGCTGGCGTATCATCGTG
GGCGTAGGTGCCGTTCCAGCCTGTCTGGCCATGTACTACCGCATCACCATCCCCGAGACGCCGCGGTATACCTTT
GACGTCCAGCATGATGTCGAAAAGGCCGATGCCGATATCCAGGCCTATGTTCAGAGCAAGACGCAGAGGGCTGCT
GGCAAAAGGTTCTCTACCACGCTGCTGACGGTTCCGAGGGCGTCGTGGGCCGATCTGGCTGCCTACTTCAGTCAT
TGGGCTCATCTACGGGTGCTGATAGGCACCACCATGTCTTGGTTCTTCCTCGACCTCGCCTTCTACGGCCTCGGA
CTCAACAGCACCATCGTCCTCGGCGCCATCGGTTACGGTAAAGGCCGCAACTTGTACGAAAAGCTATACAACCAA
GCCGTCGGCATCATCATCCTCGCCTGCGCCGGCTCTCTTCCCGGCTATCTCTTCGCCGTCCTAACCATCGACACC
ATCGGCCGCAAGCCGCTCCAAGTCACCGGCTTCCTGCTCCTCACCGTCATCTTCTGCATCCTCGGCTTCAGCCTC
AGCCGACTGAGCGAAGGCGCCATGCTGGCCCTCTACGTCATCGGCCAGTTTCTCTTCAGCGCAGGACCAAACACC
ACCACCTTTGTCGTGCCCGGAGAATGCTTCCCAACCCGCTATCGAGCTACGGGCCACGGCCTGTCAGCAGCCATG
GGCAAGATGGGCGCCGTCGTGGCCCAGGTCATGAGTATCCCGCTGCTCAAGCCGGGTTCTGATGACGCCTGTACC
ACTGGAGACCAGTGTGCAGCCAAGCTGGACCGTCTGATGCAGCTGTTTGCCCTCTTCATGTTGCTCGGCACCGTG
TCATCGCTCCTCATCCCTGAGACGAAAGGCCTGACACTCGAGGAGTTATCCGGAGAGCCCAGCACGAGCTACAAC
GCCGGCTGCAACGGGAGCATCAACCACGATACAAACACTCCCTCCCGACGCTGGAATCCCTTCCGAGGCGGCCAT
CCAGCAGGCTTCTACTACCCACGCTCCCACGCCGCAACTCTCTTCGGCAAAACCCGCCGCCGGTCACCACGAACA
GACATCATGGTCCCCTTCCAGCCGGACGCCCCGGACACAGTCTTCCCCTCCCCGTCATCAACGCCCAGCCGAGGC
CGCAGACGACGACAGTATCAGGAGCATCACCACCTACGACGTCTCATCTGGCGGCGCGAAAGCCGCAACCCGCGC
CGCGACGGAAGCGTCGAGTCCAATGAGATGACGCTTCGGGGCTGCACGCCGAGATCGGACCCGGATCATGACGCG
GGACGGAAGCCGGATGAGGTGCCGGAGTGGGGCGCCGGATGGGGCCGGATCGACCGGGGTGGACCGTCGCCGGCG
GGGAGCAGCATGCAGCTACAGGACGTGGGGATGCTGCTGGGAGGAGAGTCTACGTACTGA
Gene >Ophun1|241
ATGGGCACTCCAACCCGCACCTACGGCGGCAACCGAGCCTTCCACAACTTCTACAACGACTACTCGCATATCCCC
GACCCCAACCTCCGCCGCCGTCTGGCCCTCTCGGAGATTGACAAGGTGCCCCTCGGACTCTACCGTAAGACGCCC
AGAGGGAGGGTTCATGAAGCTACATGTAACCGGAGCTGACGAGCAGCAGATGTGCGAGCCATCATGGTGGCGGGC
GTTGGCTTCCTGCTCGACTCATACGACATCTTCGCCATTAACCTCGTTACCGTCCTGCTGGGCATGGTCTTTTGG
GGCGGGGCTCGACGTGAGGATGGCTATGGTGGGAACGGGGGTGTTTTACCGGATGGGACGAACCAGGCGCTCAAG
GGGGCTACGAGCGCGGGCATCATCGTTGGTATGGTGGTGTTTGGCTGGCTGGCAGAGTGAGTGAGCCGCTGAGAT
CAACTAGATAGATGGCTTCACTAACAGCATCAAGCACCATGGGCCGTCGAAGGATGTACGGAATCGACCTCGCCA
TCATCATCCTAGCTACCTTTAGCTGCGCCCTCGCCTCAGCCAGTCCAGCCATGGGTCCTTCAGCACTACTCATCG
CCTGGAGAGTCCTGATGGGCATCGGGATAGGAGGAGACTATCCCCTCTCTTCCGTCATAACCTCCGAGTAAGCAC
CCCATCCCACACAAACCCCCCCCAACTAACCCTCCAAGATTCGCCCCAACCCGCTGGCGAGGCGCCATGATCGCC
GCCGTCTTCTCCATGCAAGGCGTAGGCCTCCTCATGTCCGCCCTCGTCGCCCTCGTCACCACCGTCGCCTTCAAA
CCCTCCTTCATCGACATCGTCGACGAAACCCACTGTGATGCAAACTGTCAGGCTGCCGCAGACCGCTGCTGGCGT
ATCATCGTGGGCGTAGGTGCCGTTCCAGCCTGTCTGGCCATGTACTACCGCATCACCATCCCCGAGACGCCGCGG
TATACCTTTGACGTCCAGCATGATGTCGAAAAGGCCGATGCCGATATCCAGGCCTATGTTCAGAGCAAGACGCAG
AGGGCTGCTGGCAAAAGGTTCTCTACCACGCTGCTGACGGTTCCGAGGGCGTCGTGGGCCGATCTGGCTGCCTAC
TTCAGTCATTGGGCTCATCTACGGGTGCTGATAGGCACCACCATGTCTTGGTTCTTCCTCGTCCGTCTTTCTCAT
CTCTCCTCCCTCCTCCTTTCACTAAGTCGACATCAACAGGACCTCGCCTTCTACGGCCTCGGACTCAACAGCACC
ATCGTCCTCGGCGCCATCGGTTACGGTAAAGGCCGCAACTTGTACGAAAAGCTATACAACCAAGCCGTCGGCATC
ATCATCCTCGCCTGCGCCGGCTCTCTTCCCGGCTATCTCTTCGCCGTCCTAACCATCGACACCATCGGCCGCAAG
CCGCTCCAAGTCACCGGCTTCCTGCTCCTCACCGTCATCTTCTGCATCCTCGGCTTCAGCCTCAGCCGACTGAGC
GAAGGCGCCATGCTGGCCCTCTACGTCATCGGCCAGTTTCTCTTCAGCGCAGGACCAAACACCACCACCTTTGTC
GTGCCCGGAGAATGCTTCCCAACCCGCTATCGAGCTACGGGCCACGGCCTGTCAGCAGCCATGGGCAAGATGGGC
GCCGTCGTGGCCCAGGTCATGAGTATCCCGCTGCTCAAGCCGGGTTCTGATGACGCCTGTACCACTGGAGACCAG
TGTGCAGCCAAGCTGGACCGTCTGATGCAGCTGTTTGCCCTCTTCATGTTGCTCGGCACCGTGTCATCGCTCCTC
ATCCCTGAGACGAAAGGCCTGACACTCGAGGAGTTATCCGGAGAGCCCAGCACGAGCTACAACGCCGGCTGCAAC
GGGAGCATCAACCACGATACAAACACTCCCTCCCGACGCTGGAATCCCTTCCGAGGCGGCCATCCAGCAGGCTTC
TACTACCCACGCTCCCACGCCGCAACTCTCTTCGGCAAAACCCGCCGCCGGTCACCACGAACAGACATCATGGTC
CCCTTCCAGCCGGACGCCCCGGACACAGTCTTCCCCTCCCCGTCATCAACGCCCAGCCGAGGCCGCAGACGACGA
CAGTATCAGGAGCATCACCACCTACGACGTCTCATCTGGCGGCGCGAAAGCCGCAACCCGCGCCGCGACGGAAGC
GTCGAGTCCAATGAGATGACGCTTCGGGGCTGCACGCCGAGATCGGACCCGGATCATGACGCGGGACGGAAGCCG
GATGAGGTGCCGGAGTGGGGCGCCGGATGGGGCCGGATCGACCGGGGTGGACCGTCGCCGGCGGGGAGCAGCATG
CAGCTACAGGACGTGGGGATGCTGCTGGGAGGAGAGTCTACGTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail