Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2404
Gene name
LocationContig_219:16389..17916
Strand+
Gene length (bp)1527
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10355 Ytp1 Protein of unknown function (Ytp1) 4.6E-65 131 374
PF10348 DUF2427 Domain of unknown function (DUF2427) 6.3E-30 5 103

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53584|YTP1_YEAST Protein YTP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTP1 PE=1 SV=1 120 374 2.0E-65
sp|O59714|YBH6_SCHPO Uncharacterized membrane protein C3B8.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B8.06 PE=1 SV=1 112 361 3.0E-09
sp|P25639|YCV1_YEAST Uncharacterized membrane protein YCR061W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR061W PE=1 SV=2 188 339 3.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 17 39 22
2 46 68 22
3 78 100 22
4 121 143 22
5 158 180 22
6 251 273 22
7 278 300 22
8 313 335 22
9 350 372 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2404
MNIAEGESVSKDPIDTVLWVHIFVQSFAYGIVFPTGMVLGVTKSRWHVPTQIFGSVFAVLGFFLGHAHGGREFIG
NNAHSGFSTILQLLLVCQIVLGLYLKGHWEKGVNGRIRRFIRPCHSFIGKLMPVLSWTQMLFGGITALGFCQADH
FGQCLAHFIMGSTFIAYGITLSLILVVGQLWIRRTGRSQEFYDSAVIAAWGCVNTFTEHRWGSAWIRNDWQHTTM
GIIWWSAGLVGMWLSRDRDGNPKRNFVPGFVVFMTGWAMSAHPQSLMVSAMTHSMFGKTLMAVGLTRIIEIAFVL
KDKQSLTDDGRSWNSFQFVPVFLMYAAGFLFMGATEEQMLLVDQSAVDHVSYILILYSVAFIVFLFSNMLIHLYD
RLANPVENRELGLYDRLADPAVESRALGTGNGTGRVSTERRLRDCDEFELDGLMSDDDGPSSRGLDSPSSTLGKN
EATSVR*
Coding >Ophun1|2404
ATGAACATCGCAGAGGGCGAGTCGGTCTCCAAGGACCCCATCGATACGGTGCTATGGGTTCACATATTCGTCCAG
TCATTCGCCTACGGCATCGTCTTTCCCACTGGGATGGTATTGGGCGTGACGAAATCGAGATGGCACGTCCCGACC
CAAATCTTCGGCTCCGTATTCGCAGTCCTCGGCTTCTTTCTCGGTCACGCCCATGGCGGCCGTGAGTTCATCGGC
AACAACGCCCACTCGGGCTTCTCCACGATTCTGCAGCTGCTCCTCGTCTGCCAAATTGTTCTTGGGCTATATCTC
AAAGGCCACTGGGAGAAGGGGGTCAACGGCAGAATCAGGAGGTTCATCCGACCATGCCATTCCTTCATCGGCAAG
CTGATGCCGGTTCTCTCGTGGACCCAGATGCTCTTTGGCGGCATCACGGCGCTCGGCTTCTGTCAAGCCGATCAT
TTCGGCCAGTGCCTGGCTCACTTCATCATGGGAAGCACCTTTATTGCCTACGGCATCACCTTGTCCCTGATCCTC
GTCGTCGGCCAGCTGTGGATTCGTCGTACCGGACGATCGCAAGAATTCTACGACAGCGCCGTCATCGCCGCCTGG
GGCTGTGTCAATACCTTTACCGAGCACCGCTGGGGCAGCGCTTGGATCAGGAACGACTGGCAGCACACCACCATG
GGCATCATCTGGTGGAGCGCCGGCCTCGTCGGCATGTGGCTCAGCAGGGACCGGGATGGCAATCCCAAGCGCAAC
TTTGTGCCGGGCTTCGTCGTCTTCATGACGGGCTGGGCCATGTCGGCTCATCCGCAGTCGCTCATGGTCAGCGCC
ATGACGCATAGCATGTTTGGGAAGACGCTCATGGCTGTCGGCTTGACGCGCATCATCGAAATTGCATTCGTCCTC
AAGGACAAGCAGTCGCTGACGGATGACGGCCGCTCCTGGAACAGTTTCCAATTTGTTCCCGTGTTTCTTATGTAC
GCCGCGGGCTTTCTCTTTATGGGAGCGACGGAAGAGCAGATGCTGCTCGTCGACCAGTCGGCTGTCGATCACGTC
TCGTACATTCTGATATTATACTCGGTCGCCTTCATCGTCTTTTTGTTTTCCAACATGCTCATCCACCTGTACGAC
CGGCTTGCGAACCCCGTGGAGAACCGAGAGCTGGGCCTGTATGACCGGCTTGCGGACCCTGCCGTAGAGAGCAGG
GCTTTGGGTACCGGCAATGGCACTGGCCGCGTCTCGACCGAAAGGCGGTTGCGGGATTGCGACGAATTTGAGCTG
GATGGGTTAATGAGTGATGACGACGGACCATCGTCGCGCGGTCTCGACTCTCCGTCATCAACGCTGGGCAAAAAC
GAGGCCACATCGGTGCGATGA
Transcript >Ophun1|2404
ATGAACATCGCAGAGGGCGAGTCGGTCTCCAAGGACCCCATCGATACGGTGCTATGGGTTCACATATTCGTCCAG
TCATTCGCCTACGGCATCGTCTTTCCCACTGGGATGGTATTGGGCGTGACGAAATCGAGATGGCACGTCCCGACC
CAAATCTTCGGCTCCGTATTCGCAGTCCTCGGCTTCTTTCTCGGTCACGCCCATGGCGGCCGTGAGTTCATCGGC
AACAACGCCCACTCGGGCTTCTCCACGATTCTGCAGCTGCTCCTCGTCTGCCAAATTGTTCTTGGGCTATATCTC
AAAGGCCACTGGGAGAAGGGGGTCAACGGCAGAATCAGGAGGTTCATCCGACCATGCCATTCCTTCATCGGCAAG
CTGATGCCGGTTCTCTCGTGGACCCAGATGCTCTTTGGCGGCATCACGGCGCTCGGCTTCTGTCAAGCCGATCAT
TTCGGCCAGTGCCTGGCTCACTTCATCATGGGAAGCACCTTTATTGCCTACGGCATCACCTTGTCCCTGATCCTC
GTCGTCGGCCAGCTGTGGATTCGTCGTACCGGACGATCGCAAGAATTCTACGACAGCGCCGTCATCGCCGCCTGG
GGCTGTGTCAATACCTTTACCGAGCACCGCTGGGGCAGCGCTTGGATCAGGAACGACTGGCAGCACACCACCATG
GGCATCATCTGGTGGAGCGCCGGCCTCGTCGGCATGTGGCTCAGCAGGGACCGGGATGGCAATCCCAAGCGCAAC
TTTGTGCCGGGCTTCGTCGTCTTCATGACGGGCTGGGCCATGTCGGCTCATCCGCAGTCGCTCATGGTCAGCGCC
ATGACGCATAGCATGTTTGGGAAGACGCTCATGGCTGTCGGCTTGACGCGCATCATCGAAATTGCATTCGTCCTC
AAGGACAAGCAGTCGCTGACGGATGACGGCCGCTCCTGGAACAGTTTCCAATTTGTTCCCGTGTTTCTTATGTAC
GCCGCGGGCTTTCTCTTTATGGGAGCGACGGAAGAGCAGATGCTGCTCGTCGACCAGTCGGCTGTCGATCACGTC
TCGTACATTCTGATATTATACTCGGTCGCCTTCATCGTCTTTTTGTTTTCCAACATGCTCATCCACCTGTACGAC
CGGCTTGCGAACCCCGTGGAGAACCGAGAGCTGGGCCTGTATGACCGGCTTGCGGACCCTGCCGTAGAGAGCAGG
GCTTTGGGTACCGGCAATGGCACTGGCCGCGTCTCGACCGAAAGGCGGTTGCGGGATTGCGACGAATTTGAGCTG
GATGGGTTAATGAGTGATGACGACGGACCATCGTCGCGCGGTCTCGACTCTCCGTCATCAACGCTGGGCAAAAAC
GAGGCCACATCGGTGCGATGA
Gene >Ophun1|2404
ATGAACATCGCAGAGGGCGAGTCGGTCTCCAAGGACCCCATCGTGAGAGGCACCCAAGAAGCTTGCTTTCTTTTT
AATCCTGCTGACCCGGAGTGCAGGATACGGTGCTATGGGTTCACATATTCGTCCAGTCATTCGCCTACGGCATCG
TCTTTCCCACTGGGATGGTATTGGGCGTATGTTGGCCCGTTCCCCTCGTTCCGCGGCGACGCTGATCCTCTGCGA
CAGGTGACGAAATCGAGATGGCACGTCCCGACCCAAATCTTCGGCTCCGTATTCGCAGTCCTCGGCTTCTTTCTC
GGTCACGCCCATGGCGGCCGTGAGTTCATCGGCAACAACGCCCACTCGGGCTTCTCCACGATTCTGCAGCTGCTC
CTCGTCTGCCAAATTGTTCTTGGGCTATATCTCAAAGGCCACTGGGAGAAGGGGGTCAACGGCAGAATCAGGAGG
TTCATCCGACCATGCCATTCCTTCATCGGCAAGCTGATGCCGGTTCTCTCGTGGACCCAGATGCTCTTTGGCGGC
ATCACGGCGCTCGGCTTCTGTCAAGCCGATCATTTCGGCCAGTGCCTGGCTCACTTCATCATGGGAAGCACCTTT
ATTGCCTACGGCATCACCTTGTCCCTGATCCTCGTCGTCGGCCAGCTGTGGATTCGTCGTACCGGACGATCGCAA
GAATTCTACGACAGCGCCGTCATCGCCGCCTGGGGCTGTGTCAATACCTTTACCGAGCACCGCTGGGGCAGCGCT
TGGATCAGGAACGACTGGCAGCACACCACCATGGGCATCATCTGGTGGAGCGCCGGCCTCGTCGGCATGTGGCTC
AGCAGGGACCGGGATGGCAATCCCAAGCGCAACTTTGTGCCGGGCTTCGTCGTCTTCATGACGGGCTGGGCCATG
TCGGCTCATCCGCAGTCGCTCATGGTCAGCGCCATGACGCATAGCATGTTTGGGAAGACGCTCATGGCTGTCGGC
TTGACGCGCATCATCGAAATTGCATTCGTCCTCAAGGACAAGCAGTCGCTGACGGATGACGGCCGCTCCTGGAAC
AGTTTCCAATTTGTTCCCGTGTTTGTGAGTTCACCTCTCCACCCTTCGAGCTGTTGAAACTGACCATCTTAGCTT
ATGTACGCCGCGGGCTTTCTCTTTATGGGAGCGACGGAAGAGCAGATGCTGCTCGTCGACCAGTCGGCTGTCGAT
CACGTCTCGTACATTCTGATATTATACTCGGTCGCCTTCATCGTCTTTTTGTTTTCCAACATGCTCATCCACCTG
TACGACCGGCTTGCGAACCCCGTGGAGAACCGAGAGCTGGGCCTGTATGACCGGCTTGCGGACCCTGCCGTAGAG
AGCAGGGCTTTGGGTACCGGCAATGGCACTGGCCGCGTCTCGACCGAAAGGCGGTTGCGGGATTGCGACGAATTT
GAGCTGGATGGGTTAATGAGTGATGACGACGGACCATCGTCGCGCGGTCTCGACTCTCCGTCATCAACGCTGGGC
AAAAACGAGGCCACATCGGTGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail