Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|24
Gene name
LocationContig_1:58544..61913
Strand-
Gene length (bp)3369
Transcript length (bp)3111
Coding sequence length (bp)3111
Protein length (aa) 1037

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01602 Adaptin_N Adaptin N terminal region 7.2E-86 48 659

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTL8|AP3D_SCHPO AP-3 complex subunit delta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apl5 PE=3 SV=2 30 738 2.0E-140
sp|O14617|AP3D1_HUMAN AP-3 complex subunit delta-1 OS=Homo sapiens GN=AP3D1 PE=1 SV=1 30 847 2.0E-135
sp|O54774|AP3D1_MOUSE AP-3 complex subunit delta-1 OS=Mus musculus GN=Ap3d1 PE=1 SV=1 30 847 3.0E-133
sp|Q865S1|AP3D1_BOVIN AP-3 complex subunit delta-1 OS=Bos taurus GN=AP3D1 PE=1 SV=2 30 723 1.0E-130
sp|P54362|AP3D_DROME AP-3 complex subunit delta OS=Drosophila melanogaster GN=g PE=1 SV=4 30 719 3.0E-129
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTL8|AP3D_SCHPO AP-3 complex subunit delta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apl5 PE=3 SV=2 30 738 2.0E-140
sp|O14617|AP3D1_HUMAN AP-3 complex subunit delta-1 OS=Homo sapiens GN=AP3D1 PE=1 SV=1 30 847 2.0E-135
sp|O54774|AP3D1_MOUSE AP-3 complex subunit delta-1 OS=Mus musculus GN=Ap3d1 PE=1 SV=1 30 847 3.0E-133
sp|Q865S1|AP3D1_BOVIN AP-3 complex subunit delta-1 OS=Bos taurus GN=AP3D1 PE=1 SV=2 30 723 1.0E-130
sp|P54362|AP3D_DROME AP-3 complex subunit delta OS=Drosophila melanogaster GN=g PE=1 SV=4 30 719 3.0E-129
sp|Q08951|AP3D_YEAST AP-3 complex subunit delta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APL5 PE=1 SV=1 29 718 1.0E-127
sp|Q755A1|AP3D_ASHGO AP-3 complex subunit delta OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=APL5 PE=3 SV=1 29 812 1.0E-125
sp|Q54WN0|AP3D_DICDI AP-3 complex subunit delta OS=Dictyostelium discoideum GN=ap3d1 PE=3 SV=1 30 719 9.0E-115
sp|Q9C744|AP3D_ARATH AP-3 complex subunit delta OS=Arabidopsis thaliana GN=DELTA-ADR PE=1 SV=1 30 716 2.0E-84
sp|Q8I8U2|AP1G_DICDI AP-1 complex subunit gamma OS=Dictyostelium discoideum GN=ap1g1 PE=1 SV=1 34 404 4.0E-32
sp|Q5R5M2|AP1G1_PONAB AP-1 complex subunit gamma-1 OS=Pongo abelii GN=AP1G1 PE=2 SV=1 34 407 2.0E-24
sp|Q80V94|AP4E1_MOUSE AP-4 complex subunit epsilon-1 OS=Mus musculus GN=Ap4e1 PE=1 SV=3 27 585 3.0E-24
sp|P22892|AP1G1_MOUSE AP-1 complex subunit gamma-1 OS=Mus musculus GN=Ap1g1 PE=1 SV=3 34 407 5.0E-24
sp|O43747|AP1G1_HUMAN AP-1 complex subunit gamma-1 OS=Homo sapiens GN=AP1G1 PE=1 SV=5 34 407 5.0E-24
sp|Q99128|AP1G1_USTMA AP-1 complex subunit gamma-1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=APL4 PE=3 SV=3 33 407 7.0E-24
sp|Q9UPM8|AP4E1_HUMAN AP-4 complex subunit epsilon-1 OS=Homo sapiens GN=AP4E1 PE=1 SV=2 30 404 2.0E-22
sp|Q9ZUI6|AP1G2_ARATH AP-1 complex subunit gamma-2 OS=Arabidopsis thaliana GN=At1g60070 PE=1 SV=2 34 405 1.0E-21
sp|P17426|AP2A1_MOUSE AP-2 complex subunit alpha-1 OS=Mus musculus GN=Ap2a1 PE=1 SV=1 32 487 4.0E-20
sp|O95782|AP2A1_HUMAN AP-2 complex subunit alpha-1 OS=Homo sapiens GN=AP2A1 PE=1 SV=3 32 487 4.0E-20
sp|O75843|AP1G2_HUMAN AP-1 complex subunit gamma-like 2 OS=Homo sapiens GN=AP1G2 PE=1 SV=1 34 407 2.0E-19
sp|O88512|AP1G2_MOUSE AP-1 complex subunit gamma-like 2 OS=Mus musculus GN=Ap1g2 PE=1 SV=2 34 407 3.0E-18
sp|Q9UU81|AP1G1_SCHPO AP-1 complex subunit gamma-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apl4 PE=3 SV=1 33 413 3.0E-18
sp|Q8L7A9|AP4E_ARATH AP-4 complex subunit epsilon OS=Arabidopsis thaliana GN=At1g31730 PE=1 SV=1 75 406 4.0E-18
sp|P91926|AP2A_DROME AP-2 complex subunit alpha OS=Drosophila melanogaster GN=AP-2alpha PE=1 SV=1 32 487 4.0E-18
sp|P17427|AP2A2_MOUSE AP-2 complex subunit alpha-2 OS=Mus musculus GN=Ap2a2 PE=1 SV=2 32 487 5.0E-18
sp|P18484|AP2A2_RAT AP-2 complex subunit alpha-2 OS=Rattus norvegicus GN=Ap2a2 PE=1 SV=3 32 487 5.0E-18
sp|Q7QG73|AP2A_ANOGA AP-2 complex subunit alpha OS=Anopheles gambiae GN=alpha-Adaptin PE=3 SV=4 32 487 5.0E-18
sp|O94973|AP2A2_HUMAN AP-2 complex subunit alpha-2 OS=Homo sapiens GN=AP2A2 PE=1 SV=2 32 487 2.0E-17
sp|Q29N38|AP2A_DROPS AP-2 complex subunit alpha OS=Drosophila pseudoobscura pseudoobscura GN=alpha-Adaptin PE=3 SV=1 32 487 3.0E-17
sp|Q86KI1|AP2A2_DICDI AP-2 complex subunit alpha-2 OS=Dictyostelium discoideum GN=ap2a1-1 PE=3 SV=1 32 553 3.0E-17
sp|Q0VCK5|AP2A2_BOVIN AP-2 complex subunit alpha-2 OS=Bos taurus GN=AP2A2 PE=1 SV=1 32 487 6.0E-17
sp|Q8LPL6|AP2A1_ARATH AP-2 complex subunit alpha-1 OS=Arabidopsis thaliana GN=ALPHA-ADR PE=1 SV=1 32 410 4.0E-16
sp|Q8LPK4|AP2A2_ARATH AP-2 complex subunit alpha-2 OS=Arabidopsis thaliana GN=ALPHAC-AD PE=1 SV=1 32 410 6.0E-16
sp|Q9C0W7|AP2A_SCHPO AP-2 complex subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apl3 PE=3 SV=1 32 659 3.0E-14
sp|Q84K16|AP1G1_ARATH AP-1 complex subunit gamma-1 OS=Arabidopsis thaliana GN=GAMMA-ADR PE=1 SV=1 34 207 9.0E-13
sp|Q54VE0|AP4E_DICDI AP-4 complex subunit epsilon OS=Dictyostelium discoideum GN=ap4e1 PE=3 SV=1 26 232 3.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0030117 membrane coat Yes
GO:0016192 vesicle-mediated transport Yes
GO:0051179 localization No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0008104 protein localization No
GO:0046907 intracellular transport No
GO:0051234 establishment of localization No
GO:0098796 membrane protein complex No
GO:0032991 protein-containing complex No
GO:0051649 establishment of localization in cell No
GO:0071705 nitrogen compound transport No
GO:0033036 macromolecule localization No
GO:0070727 cellular macromolecule localization No
GO:0005575 cellular_component No
GO:0015031 protein transport No
GO:0045184 establishment of protein localization No
GO:0008150 biological_process No
GO:0051641 cellular localization No
GO:0071702 organic substance transport No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1858
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6911
Ophiocordyceps australis map64 (Brazil) OphauB2|3764
Ophiocordyceps camponoti-floridani Ophcf2|04764
Ophiocordyceps camponoti-rufipedis Ophun1|24 (this protein)
Ophiocordyceps kimflemingae Ophio5|5746
Ophiocordyceps subramaniannii Hirsu2|1885

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|24
MGLIRRRSPQPPPKRHHERVAAQHHVRTWFEKSLYDLIRGLRNHKGNEKDYIQKSLKECRSEVRSQDMDVKATAL
LKLVYLEMVGYDMSWASFHVLEVMSSAKYHQKRVGYLGAVQSFRPDTEVLMLATNLLKKDLASSTPTVISLPIAT
LPHVITPSLALSTLADLLPRLGHSNANIRKKTLVTLYRLALVYPEALRAAWPKIKERLLNTEEDPSVTAAIVNVV
CELGWRRPHDFLPLAPRLFELLVDGGNNWMAIKLIKLFATLTPLEPRLVKKLLPPLTNIMATTAAMSLLYECING
IIQGGILGSSEDASGADEVATLCVTKLRSMVVINSDPNLKYVALLAFNKIVITHPYLVAQQEDVILECIDSPDIT
IRIQALDLVQGMVTSGNLVSVVSRLMKQLKSATSSTAQRNPEPSPHVTGADSDDEPTDAVAAETEDRPPPLPEDY
LIDVIKRILLMCSRDNYSNVADFDWYVDVLTQLVRVAPVPRTYDADFAVDASLRHATDVSEKIGDELRNVAVKVR
AMRATAVRAAEAILANVSGDTPSGHKMVLGALNSIVWMLGEYSDQLSSPEDTLNHLLQVVSRAGGPELCTTALFA
VLKVFASVAGDDLEPWSAERKCRTSLLLARIINVTEPLALHPNLEVQERAVQLVELLKLTAEATSEQPASTDHER
RDPPLLLTQAIPSLLNGWELNSVASGAQRNVPKPEGLDLDEPIHPNLSQLLSQADVVLLQSDDLDEFESYYNQRP
PPSSLSSSSPAMALLARPNDEIIGSYQQPSEESYLDADIIARRKAERQERNKDDPFYIPSSNDIRQASTPIHNIL
QNSNGPDLDIDSIPIMQLDLGTIDMAKSAPAPKPRPSPRQKVIIAADETLEGSDSRTYESENNNSDGKLRAKSRF
KQSLLQVDSSTIGSFNLEGNSSRAGRGFDYERQQREEAEMQQAVKEVERLRLKMQRSKERAQVAQGVDAAGTVIK
KKKSVSKAAASAAGGEVKPKKKKKKKKTTAGEEAGAAESSNLDSMPAAGDAPSDRLAVEGN*
Coding >Ophun1|24
ATGGGCCTGATACGACGCCGATCACCACAACCACCCCCCAAGCGTCACCACGAGAGAGTCGCGGCCCAGCATCAT
GTAAGGACATGGTTCGAGAAATCGCTTTACGATCTCATCCGAGGCCTGCGAAACCACAAGGGCAATGAGAAGGAT
TATATCCAGAAGAGCCTCAAGGAGTGCCGCTCCGAGGTTCGCAGCCAGGACATGGATGTGAAGGCGACGGCACTC
CTCAAGCTCGTCTACCTGGAAATGGTGGGCTACGACATGTCATGGGCCTCGTTCCACGTCCTCGAGGTCATGTCG
TCGGCCAAATACCACCAGAAGCGCGTCGGCTACCTTGGCGCCGTGCAGAGCTTCCGGCCCGATACCGAGGTGCTC
ATGCTGGCCACAAATCTCCTCAAAAAGGACCTCGCATCGTCAACTCCAACCGTCATTTCCTTGCCCATCGCCACA
TTGCCGCACGTCATCACGCCCTCTCTCGCCCTCTCGACCCTGGCAGACTTGCTTCCCCGCCTTGGCCACAGCAAC
GCCAATATCCGCAAGAAGACTCTCGTCACGCTCTACCGGCTGGCCCTGGTCTATCCCGAGGCCCTGCGCGCTGCC
TGGCCCAAGATCAAGGAGCGCCTACTAAACACTGAAGAGGACCCCAGCGTGACGGCAGCCATCGTCAACGTTGTC
TGCGAGCTGGGCTGGCGTCGACCTCATGACTTTCTCCCCCTTGCTCCGCGCCTCTTTGAGCTCCTGGTCGATGGC
GGTAACAACTGGATGGCCATCAAGCTCATCAAGCTCTTTGCCACTCTCACCCCTCTGGAGCCCCGACTCGTCAAG
AAGCTGCTGCCGCCACTTACAAATATCATGGCGACGACTGCGGCCATGTCTCTCCTTTACGAGTGCATCAACGGA
ATTATACAAGGTGGCATCCTGGGCAGCAGCGAGGATGCCTCGGGTGCCGACGAGGTTGCCACGCTGTGCGTTACC
AAGCTAAGGAGCATGGTTGTCATCAACAGTGATCCAAACTTGAAATACGTCGCGCTACTGGCCTTTAACAAGATC
GTCATCACCCATCCTTACCTCGTCGCGCAGCAAGAAGATGTCATTCTCGAGTGCATCGACAGCCCCGACATTACG
ATTCGTATACAAGCGCTGGACCTAGTTCAGGGCATGGTTACAAGCGGCAACCTCGTGTCAGTCGTCAGTCGATTG
ATGAAGCAACTCAAGTCGGCGACGAGCTCCACCGCGCAACGGAATCCAGAGCCCAGCCCTCATGTAACCGGCGCC
GACTCGGATGATGAACCGACGGATGCCGTAGCGGCGGAGACGGAGGACCGGCCGCCCCCTCTTCCGGAGGACTAC
CTCATTGACGTTATCAAAAGGATTCTGTTGATGTGCTCGCGGGACAACTACTCGAATGTGGCCGACTTTGACTGG
TACGTCGACGTCTTGACGCAGCTTGTCCGTGTGGCGCCCGTGCCTCGGACATACGACGCCGACTTCGCGGTCGAC
GCCTCACTTCGTCATGCAACAGATGTGTCCGAGAAGATTGGCGACGAACTCCGGAACGTCGCAGTCAAGGTCCGG
GCCATGAGAGCCACGGCGGTGCGGGCTGCTGAGGCGATTCTCGCCAACGTCAGCGGGGACACTCCCTCCGGCCAT
AAGATGGTGTTGGGAGCCCTCAACTCGATCGTCTGGATGCTGGGTGAATATTCCGACCAGCTATCGTCCCCGGAA
GACACCCTCAACCACTTGCTTCAAGTGGTGTCTCGGGCAGGAGGGCCCGAGCTCTGTACCACTGCGCTCTTCGCC
GTCCTCAAGGTGTTTGCGTCAGTGGCAGGCGACGATCTTGAACCGTGGTCTGCCGAGAGGAAGTGCAGGACGAGT
CTGCTTCTGGCGCGCATCATCAACGTGACAGAACCGTTGGCACTGCATCCGAATCTCGAGGTCCAGGAGCGCGCC
GTTCAACTCGTCGAACTACTGAAGCTCACGGCCGAGGCCACATCTGAGCAGCCTGCATCTACGGACCATGAGCGA
CGAGATCCGCCCCTTCTCCTGACGCAAGCTATCCCTTCGCTACTCAACGGCTGGGAGCTCAACTCGGTCGCCTCC
GGGGCTCAGCGCAACGTGCCCAAACCCGAGGGTCTTGATCTAGACGAGCCCATCCACCCGAACTTGAGCCAGCTA
CTCTCGCAGGCTGACGTCGTCTTGCTGCAGTCGGACGATCTGGACGAGTTCGAGTCATACTATAACCAGCGGCCG
CCACCTTCGAGCCTTTCGTCTTCGTCGCCCGCTATGGCACTGTTGGCACGGCCCAACGATGAGATAATCGGCTCG
TATCAGCAACCGTCTGAGGAGAGCTACCTCGACGCCGACATCATCGCGCGCAGGAAAGCCGAGCGGCAGGAGAGG
AACAAGGATGACCCGTTCTACATACCCAGCAGCAACGACATCCGACAAGCTTCCACTCCAATCCACAATATCCTG
CAGAACAGTAACGGCCCAGACCTCGATATCGACTCCATACCTATCATGCAGCTCGATCTCGGGACCATTGACATG
GCCAAGTCGGCCCCGGCGCCGAAACCGCGCCCATCGCCTCGCCAGAAAGTAATCATCGCAGCAGACGAGACGCTT
GAAGGCAGCGACAGCCGCACCTACGAATCCGAAAACAACAATTCCGATGGCAAGCTCAGAGCCAAGTCGCGGTTC
AAGCAATCCCTACTGCAGGTCGACTCCAGCACCATCGGCTCCTTCAACCTCGAAGGCAACAGCAGCAGAGCCGGC
CGCGGCTTCGACTACGAAAGACAGCAGCGCGAGGAGGCGGAGATGCAACAGGCCGTCAAGGAGGTTGAGAGGTTA
CGACTCAAGATGCAGCGTTCCAAGGAGAGGGCTCAGGTGGCGCAGGGGGTCGATGCCGCGGGCACCGTCATCAAG
AAGAAGAAGTCCGTCTCCAAGGCTGCTGCCTCAGCCGCTGGCGGAGAGGTCAAGCCTAAGAAGAAGAAGAAGAAG
AAGAAAACGACGGCTGGGGAGGAGGCGGGAGCGGCCGAGTCGAGTAATTTGGACTCGATGCCGGCGGCTGGTGAT
GCGCCCTCTGATAGACTTGCAGTCGAGGGCAATTGA
Transcript >Ophun1|24
ATGGGCCTGATACGACGCCGATCACCACAACCACCCCCCAAGCGTCACCACGAGAGAGTCGCGGCCCAGCATCAT
GTAAGGACATGGTTCGAGAAATCGCTTTACGATCTCATCCGAGGCCTGCGAAACCACAAGGGCAATGAGAAGGAT
TATATCCAGAAGAGCCTCAAGGAGTGCCGCTCCGAGGTTCGCAGCCAGGACATGGATGTGAAGGCGACGGCACTC
CTCAAGCTCGTCTACCTGGAAATGGTGGGCTACGACATGTCATGGGCCTCGTTCCACGTCCTCGAGGTCATGTCG
TCGGCCAAATACCACCAGAAGCGCGTCGGCTACCTTGGCGCCGTGCAGAGCTTCCGGCCCGATACCGAGGTGCTC
ATGCTGGCCACAAATCTCCTCAAAAAGGACCTCGCATCGTCAACTCCAACCGTCATTTCCTTGCCCATCGCCACA
TTGCCGCACGTCATCACGCCCTCTCTCGCCCTCTCGACCCTGGCAGACTTGCTTCCCCGCCTTGGCCACAGCAAC
GCCAATATCCGCAAGAAGACTCTCGTCACGCTCTACCGGCTGGCCCTGGTCTATCCCGAGGCCCTGCGCGCTGCC
TGGCCCAAGATCAAGGAGCGCCTACTAAACACTGAAGAGGACCCCAGCGTGACGGCAGCCATCGTCAACGTTGTC
TGCGAGCTGGGCTGGCGTCGACCTCATGACTTTCTCCCCCTTGCTCCGCGCCTCTTTGAGCTCCTGGTCGATGGC
GGTAACAACTGGATGGCCATCAAGCTCATCAAGCTCTTTGCCACTCTCACCCCTCTGGAGCCCCGACTCGTCAAG
AAGCTGCTGCCGCCACTTACAAATATCATGGCGACGACTGCGGCCATGTCTCTCCTTTACGAGTGCATCAACGGA
ATTATACAAGGTGGCATCCTGGGCAGCAGCGAGGATGCCTCGGGTGCCGACGAGGTTGCCACGCTGTGCGTTACC
AAGCTAAGGAGCATGGTTGTCATCAACAGTGATCCAAACTTGAAATACGTCGCGCTACTGGCCTTTAACAAGATC
GTCATCACCCATCCTTACCTCGTCGCGCAGCAAGAAGATGTCATTCTCGAGTGCATCGACAGCCCCGACATTACG
ATTCGTATACAAGCGCTGGACCTAGTTCAGGGCATGGTTACAAGCGGCAACCTCGTGTCAGTCGTCAGTCGATTG
ATGAAGCAACTCAAGTCGGCGACGAGCTCCACCGCGCAACGGAATCCAGAGCCCAGCCCTCATGTAACCGGCGCC
GACTCGGATGATGAACCGACGGATGCCGTAGCGGCGGAGACGGAGGACCGGCCGCCCCCTCTTCCGGAGGACTAC
CTCATTGACGTTATCAAAAGGATTCTGTTGATGTGCTCGCGGGACAACTACTCGAATGTGGCCGACTTTGACTGG
TACGTCGACGTCTTGACGCAGCTTGTCCGTGTGGCGCCCGTGCCTCGGACATACGACGCCGACTTCGCGGTCGAC
GCCTCACTTCGTCATGCAACAGATGTGTCCGAGAAGATTGGCGACGAACTCCGGAACGTCGCAGTCAAGGTCCGG
GCCATGAGAGCCACGGCGGTGCGGGCTGCTGAGGCGATTCTCGCCAACGTCAGCGGGGACACTCCCTCCGGCCAT
AAGATGGTGTTGGGAGCCCTCAACTCGATCGTCTGGATGCTGGGTGAATATTCCGACCAGCTATCGTCCCCGGAA
GACACCCTCAACCACTTGCTTCAAGTGGTGTCTCGGGCAGGAGGGCCCGAGCTCTGTACCACTGCGCTCTTCGCC
GTCCTCAAGGTGTTTGCGTCAGTGGCAGGCGACGATCTTGAACCGTGGTCTGCCGAGAGGAAGTGCAGGACGAGT
CTGCTTCTGGCGCGCATCATCAACGTGACAGAACCGTTGGCACTGCATCCGAATCTCGAGGTCCAGGAGCGCGCC
GTTCAACTCGTCGAACTACTGAAGCTCACGGCCGAGGCCACATCTGAGCAGCCTGCATCTACGGACCATGAGCGA
CGAGATCCGCCCCTTCTCCTGACGCAAGCTATCCCTTCGCTACTCAACGGCTGGGAGCTCAACTCGGTCGCCTCC
GGGGCTCAGCGCAACGTGCCCAAACCCGAGGGTCTTGATCTAGACGAGCCCATCCACCCGAACTTGAGCCAGCTA
CTCTCGCAGGCTGACGTCGTCTTGCTGCAGTCGGACGATCTGGACGAGTTCGAGTCATACTATAACCAGCGGCCG
CCACCTTCGAGCCTTTCGTCTTCGTCGCCCGCTATGGCACTGTTGGCACGGCCCAACGATGAGATAATCGGCTCG
TATCAGCAACCGTCTGAGGAGAGCTACCTCGACGCCGACATCATCGCGCGCAGGAAAGCCGAGCGGCAGGAGAGG
AACAAGGATGACCCGTTCTACATACCCAGCAGCAACGACATCCGACAAGCTTCCACTCCAATCCACAATATCCTG
CAGAACAGTAACGGCCCAGACCTCGATATCGACTCCATACCTATCATGCAGCTCGATCTCGGGACCATTGACATG
GCCAAGTCGGCCCCGGCGCCGAAACCGCGCCCATCGCCTCGCCAGAAAGTAATCATCGCAGCAGACGAGACGCTT
GAAGGCAGCGACAGCCGCACCTACGAATCCGAAAACAACAATTCCGATGGCAAGCTCAGAGCCAAGTCGCGGTTC
AAGCAATCCCTACTGCAGGTCGACTCCAGCACCATCGGCTCCTTCAACCTCGAAGGCAACAGCAGCAGAGCCGGC
CGCGGCTTCGACTACGAAAGACAGCAGCGCGAGGAGGCGGAGATGCAACAGGCCGTCAAGGAGGTTGAGAGGTTA
CGACTCAAGATGCAGCGTTCCAAGGAGAGGGCTCAGGTGGCGCAGGGGGTCGATGCCGCGGGCACCGTCATCAAG
AAGAAGAAGTCCGTCTCCAAGGCTGCTGCCTCAGCCGCTGGCGGAGAGGTCAAGCCTAAGAAGAAGAAGAAGAAG
AAGAAAACGACGGCTGGGGAGGAGGCGGGAGCGGCCGAGTCGAGTAATTTGGACTCGATGCCGGCGGCTGGTGAT
GCGCCCTCTGATAGACTTGCAGTCGAGGGCAATTGA
Gene >Ophun1|24
ATGGGCCTGATACGACGCCGATCACCACAACCACCCCCCAAGCGTCACCACGAGAGAGTCGCGGCCCAGCATCAT
GTAAGGACATGGTGACGCAGAGTGCGCCTAACGGCCGAGGGCTGACGCGCCCGACAGGTTCGAGAAATCGCTTTA
CGATCTCATCCGAGGCCTGCGAAACCACAAGGGCAATGAGAAGGATTATATCCAGAAGAGCCTCAAGGAGTGCCG
CTCCGAGGTTCGCAGCCAGGACATGGGTTCGCTTGCCTCACCGTCTCTCGGTCCCGGCATCGGCTGATTCAGCGC
AGATGTGAAGGCGACGGCACTCCTCAAGCTCGTCTACCTGGAAATGGTGGGCTACGACATGTCATGGGCCTCGTT
CCACGTCCTCGAGGTCATGTCGTCGGCCAAATACCACCAGAAGCGCGTCGGCTACCTTGGCGCCGTGCAGAGCTT
CCGGCCCGATACCGAGGTGCTCATGCTGGCCACAAATCTCCTCAAAAAGGTTCGTCCCTGTCGTCAGTCTCTACC
TACGCGCGCAGCCACTTATGGCCCTCGGTCCAGGACCTCGCATCGTCAACTCCAACCGTCATTTCCTTGCCCATC
GCCACATTGCCGCACGTCATCACGCCCTCTCTCGCCCTCTCGACCCTGGCAGACTTGCTTCCCCGCCTTGGCCAC
AGCAACGCCAATATCCGCAAGAAGACTCTCGTCACGCTCTACCGGCTGGCCCTGGTCTATCCCGAGGCCCTGCGC
GCTGCCTGGCCCAAGATCAAGGAGCGCCTACTAAACACTGAAGAGGACCCCAGCGTGACGGCAGCCATCGTCAAC
GTTGTCTGCGAGCTGGGCTGGCGTCGACCTCATGACTTTCTCCCCCTTGCTCCGCGCCTCTTTGAGCTCCTGGTC
GATGGCGGTAACAACTGGATGGCCATCAAGCTCATCAAGCTCGTGCGTATCCATCACCTGTGTTTGAGTTGTCCT
GTACTGACGACCTCAGTTTGCCACTCTCACCCCTCTGGAGCCCCGACTCGTCAAGAAGCTGCTGCCGCCACTTAC
AAATATCATGGCGACGACTGCGGCCATGTCTCTCCTTTACGAGTGCATCAACGGAATTATACAAGGTGGCATCCT
GGGCAGCAGCGAGGATGCCTCGGGTGCCGACGAGGTTGCCACGCTGTGCGTTACCAAGCTAAGGAGCATGGTTGT
CATCAACAGTGATCCAAACTGTATGCCCCTCGGCGCCTCTCGAGCACCATCTTGAACTCACACGATGGTGTAGTG
AAATACGTCGCGCTACTGGCCTTTAACAAGATCGTCATCACCCATCCTTACCTCGTCGCGCAGCAAGAAGATGTC
ATTCTCGAGTGCATCGACAGCCCCGACATTACGATTCGTATACAAGCGCTGGACCTAGTTCAGGGCATGGTTACA
AGCGGCAACCTCGTGTCAGTCGTCAGTCGATTGATGAAGCAACTCAAGTCGGCGACGAGCTCCACCGCGCAACGG
AATCCAGAGCCCAGCCCTCATGTAACCGGCGCCGACTCGGATGATGAACCGACGGATGCCGTAGCGGCGGAGACG
GAGGACCGGCCGCCCCCTCTTCCGGAGGACTACCTCATTGACGTTATCAAAAGGATTCTGTTGATGTGCTCGCGG
GACAACTACTCGAATGTGGCCGACTTTGACTGGTACGTCGACGTCTTGACGCAGCTTGTCCGTGTGGCGCCCGTG
CCTCGGACATACGACGCCGACTTCGCGGTCGACGCCTCACTTCGTCATGCAACAGATGTGTCCGAGAAGATTGGC
GACGAACTCCGGAACGTCGCAGTCAAGGTCCGGGCCATGAGAGCCACGGCGGTGCGGGCTGCTGAGGCGATTCTC
GCCAACGTCAGCGGGGACACTCCCTCCGGCCATAAGATGGTGTTGGGAGCCCTCAACTCGATCGTCTGGATGCTG
GGTGAATATTCCGACCAGCTATCGTCCCCGGAAGACACCCTCAACCACTTGCTTCAAGTGGTGTCTCGGGCAGGA
GGGCCCGAGCTCTGTACCACTGCGCTCTTCGCCGTCCTCAAGGTGTTTGCGTCAGTGGCAGGCGACGATCTTGAA
CCGTGGTCTGCCGAGAGGAAGTGCAGGACGAGTCTGCTTCTGGCGCGCATCATCAACGTGACAGAACCGTTGGCA
CTGCATCCGAATCTCGAGGTCCAGGAGCGCGCCGTTCAACTCGTCGAACTACTGAAGCTCACGGCCGAGGCCACA
TCTGAGCAGCCTGCATCTACGGACCATGAGCGACGAGATCCGCCCCTTCTCCTGACGCAAGCTATCCCTTCGCTA
CTCAACGGCTGGGAGCTCAACTCGGTCGCCTCCGGGGCTCAGCGCAACGTGCCCAAACCCGAGGGTCTTGATCTA
GACGAGCCCATCCACCCGAACTTGAGCCAGCTACTCTCGCAGGCTGACGTCGTCTTGCTGCAGTCGGACGATCTG
GACGAGTTCGAGTCATACTATAACCAGCGGCCGCCACCTTCGAGCCTTTCGTCTTCGTCGCCCGCTATGGCACTG
TTGGCACGGCCCAACGATGAGATAATCGGCTCGTATCAGCAACCGTCTGAGGAGAGCTACCTCGACGCCGACATC
ATCGCGCGCAGGAAAGCCGAGCGGCAGGAGAGGAACAAGGATGACCCGTTCTACATACCCAGCAGCAACGACATC
CGACAAGCTTCCACTCCAATCCACAATATCCTGCAGAACAGTAACGGCCCAGACCTCGATATCGACTCCATACCT
ATCATGCAGCTCGATCTCGGGACCATTGACATGGCCAAGTCGGCCCCGGCGCCGAAACCGCGCCCATCGCCTCGC
CAGAAAGTAATCATCGCAGCAGACGAGACGCTTGAAGGCAGCGACAGCCGCACCTACGAATCCGAAAACAACAAT
TCCGATGGCAAGCTCAGAGCCAAGTCGCGGTTCAAGCAATCCCTACTGCAGGTCGACTCCAGCACCATCGGCTCC
TTCAACCTCGAAGGCAACAGCAGCAGAGCCGGCCGCGGCTTCGACTACGAAAGACAGCAGCGCGAGGAGGCGGAG
ATGCAACAGGCCGTCAAGGAGGTTGAGAGGTTACGACTCAAGATGCAGCGTTCCAAGGAGAGGGCTCAGGTGGCG
CAGGGGGTCGATGCCGCGGGCACCGTCATCAAGAAGAAGAAGTCCGTCTCCAAGGCTGCTGCCTCAGCCGCTGGC
GGAGAGGTCAAGCCTAAGAAGAAGAAGAAGAAGAAGAAAACGACGGCTGGGGAGGAGGCGGGAGCGGCCGAGTCG
AGTAATTTGGACTCGATGCCGGCGGCTGGTGATGCGCCCTCTGATAGACTTGCAGTCGAGGGCAATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail