Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2391
Gene name
LocationContig_218:24182..27308
Strand+
Gene length (bp)3126
Transcript length (bp)2922
Coding sequence length (bp)2922
Protein length (aa) 974

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 3.5E-36 237 604

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94543|YCD3_SCHPO Uncharacterized membrane protein C1322.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1322.03 PE=3 SV=1 189 651 1.0E-45

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.5

Transmembrane Domains

Domain # Start End Length
1 54 76 22
2 233 255 22
3 366 388 22
4 415 437 22
5 444 466 22
6 486 508 22
7 521 543 22
8 558 580 22
9 585 607 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2391
MRRREGTTITTTTKTKTKTTIDDDDVPRRHRPLFSSPRHNLPERRSARARPASTLLVITLTLLTLLLLSASPASA
ARVPVASCLSSAPSQLQWRPIYADARFSGADNNYRLELVVWGNVSGSLDQAASLPPPGDAHWTRPQETEGKIAES
ADKPDVESRKATTLIRKVNVLTTAPRGLLPSVNLSHDFFSPYSFASFAPTIRIIYGDAKKTNVGCITAVVTPDLA
SVAWLPRFLPLVILLISGLAVVLAAVFSPWGSTSIVHWSSNYGRDADLLRLVTPGFGDCLQYIQFVVLTGALSLS
YPGYYQPVVAQAAWSALIFNQSVVTGAPSWQSVVDGIYVTNSSDGYGLQQLGQLAGMARSADVWPGFMVWLGVIL
VGLFVAIQTGFLARWLWRRLNHIPEEDLRAKNVPFTVGNLVRAVFNYMLVPIVALSCFQLVVARSSPAFTVALAV
LTLVLLLVSAAWMLALVIRTRPKSVLFDDLPTLLRIGPLYNTYSDQVAAFALIPVVLNLMRGIAIGAVQPSGVAQ
IVLLAICEVIQVFTLHAFRPFPAPTSMNAYHTVFSLLRAITLLLMVAFVPSLGVAEGRKCWIGYAILLIHAAVLV
LGFFLSALKTMVEVLARLLGAGGDDHVGLRRGGLSKIFGMRQLSRRETHRPGISRASHLSTAAILEMEDGSRAPA
GSRIRSVSTASLSQHLSHNQNLHHRQRSSSALDSIDLYASVGSRNADHSVSGVSYAPGETAFSFLASPRQAVSPA
AAAVETADPYYRPPRRRRDTLGAGDAPYTDAPRAGEVEPKQPIQGSGAGLSGEVALELPEEAARGATTTQLPLNA
VTMDFPPNRPDYATREVDFYYGVRGPALNSVGPGRKLGTGPADPTGPVATATGWFRNMFKGKKTKEKGKGFEVVR
SSRMPPASFGDETPPEGIPVAMGVLRNGPIDSDDDSLDSRKKPRRRRPDHLLTDTGDAQSVDASGPDSPSPGG*
Coding >Ophun1|2391
ATGCGTCGACGAGAGGGGACGACGATAACGACGACGACGAAGACCAAGACCAAGACGACGATAGACGACGACGAC
GTCCCCAGACGCCACCGCCCTCTCTTCTCATCGCCGCGCCACAACCTCCCTGAAAGACGCTCGGCTCGCGCCCGC
CCCGCCAGCACCCTCCTCGTCATCACCCTCACCCTCCTCACCCTCCTCCTCCTCTCAGCCTCTCCCGCATCAGCA
GCACGCGTCCCCGTGGCCTCGTGCCTGAGCTCGGCCCCTTCCCAGCTACAATGGCGCCCGATATACGCCGACGCC
CGCTTCAGCGGCGCAGACAACAACTACCGGCTCGAGCTGGTGGTTTGGGGCAACGTCTCCGGGTCGCTCGACCAG
GCGGCGTCGTTGCCTCCTCCGGGGGATGCGCATTGGACGAGGCCGCAAGAGACGGAGGGCAAGATTGCTGAGTCG
GCGGATAAGCCTGATGTGGAGAGTCGGAAGGCGACGACGTTGATTCGCAAGGTTAATGTCTTGACCACCGCTCCT
CGCGGCCTCCTCCCCTCGGTTAACCTCAGCCACGACTTCTTCTCTCCCTACTCCTTCGCCTCCTTCGCCCCGACC
ATCCGCATCATCTATGGCGATGCAAAGAAAACGAACGTCGGCTGCATTACCGCCGTCGTCACCCCCGATCTGGCC
TCGGTCGCCTGGCTGCCGCGTTTCCTACCGCTCGTCATCCTCCTCATCTCGGGCCTGGCCGTCGTCTTGGCCGCC
GTCTTCAGCCCCTGGGGCTCAACCAGCATAGTCCACTGGTCGTCCAACTACGGCCGAGACGCCGACCTGCTGCGC
CTCGTCACCCCCGGCTTCGGCGATTGTCTGCAGTACATCCAGTTCGTCGTCCTCACTGGCGCCCTCTCCCTCAGC
TACCCGGGCTACTACCAGCCCGTCGTCGCCCAGGCCGCCTGGTCGGCTCTCATTTTCAACCAGAGCGTCGTCACC
GGTGCGCCCTCGTGGCAGAGCGTCGTCGACGGCATCTACGTCACAAACAGCTCCGACGGTTATGGCCTGCAGCAG
CTCGGCCAGCTCGCCGGCATGGCCCGCAGCGCCGACGTCTGGCCGGGATTCATGGTCTGGCTGGGCGTCATCCTC
GTCGGCCTCTTCGTCGCGATCCAGACTGGATTTCTTGCTCGCTGGCTCTGGAGGAGGCTCAACCACATCCCCGAG
GAGGACCTGCGGGCCAAGAACGTGCCCTTTACCGTCGGTAACCTCGTCCGCGCCGTCTTCAACTACATGCTCGTC
CCCATCGTTGCCCTCTCGTGCTTCCAGCTCGTCGTCGCCCGCTCTTCTCCCGCCTTTACCGTCGCCCTCGCCGTT
CTGACGCTCGTCTTGCTCCTCGTCTCAGCCGCCTGGATGCTGGCCCTCGTCATCCGCACTCGGCCCAAGTCGGTC
CTCTTCGACGACCTGCCCACGCTCCTGCGCATCGGGCCCCTCTACAACACCTACTCGGACCAGGTGGCCGCCTTT
GCTCTCATCCCCGTCGTCCTCAACCTGATGCGCGGCATCGCCATCGGCGCCGTTCAGCCCAGCGGCGTCGCTCAG
ATCGTTCTGCTCGCCATCTGCGAGGTCATCCAGGTCTTTACCCTCCACGCCTTCCGCCCCTTTCCCGCTCCCACG
TCCATGAACGCCTATCACACCGTCTTCTCCTTACTGAGGGCCATCACCCTGCTGCTCATGGTGGCCTTTGTCCCC
AGCCTGGGCGTCGCCGAGGGCCGCAAGTGCTGGATCGGATACGCCATCCTACTCATCCACGCCGCCGTCCTCGTC
CTCGGTTTCTTTCTCTCGGCGCTCAAGACCATGGTCGAGGTGCTGGCCCGTCTACTCGGTGCCGGCGGCGATGAC
CACGTCGGTCTACGTCGCGGTGGCCTCTCCAAGATATTCGGAATGCGCCAGCTCTCGAGGCGAGAGACGCACCGT
CCGGGTATCTCGCGCGCCAGTCACTTGTCGACGGCCGCCATCTTGGAGATGGAGGACGGCAGCAGAGCCCCGGCC
GGAAGCAGGATTCGGTCCGTCTCGACGGCCAGCCTCTCCCAGCACCTCTCCCACAACCAGAACCTCCACCATCGA
CAGCGGAGCAGCTCGGCGCTCGACAGCATCGATCTCTACGCCAGCGTCGGATCGCGAAACGCCGATCACTCCGTC
AGCGGCGTCTCGTACGCGCCCGGCGAGACGGCCTTTTCCTTCCTGGCATCGCCGCGCCAGGCCGTCTCCCCCGCC
GCCGCCGCCGTCGAGACTGCTGACCCGTACTATCGCCCTCCTCGGCGGCGGCGAGATACGCTGGGCGCCGGAGAC
GCCCCCTACACGGACGCGCCCCGCGCCGGCGAGGTCGAGCCGAAGCAGCCGATTCAAGGCTCCGGCGCCGGCTTG
TCGGGCGAAGTGGCCCTCGAGCTCCCGGAGGAGGCGGCCCGGGGCGCTACGACGACGCAGCTGCCGCTCAACGCC
GTCACGATGGATTTCCCGCCTAACCGTCCGGATTACGCGACGCGCGAGGTCGACTTTTACTACGGCGTTCGCGGA
CCGGCTCTCAACTCGGTCGGTCCCGGCAGGAAGCTGGGGACGGGGCCGGCGGATCCGACGGGGCCCGTTGCCACC
GCCACCGGCTGGTTCCGCAACATGTTCAAGGGCAAGAAGACCAAGGAAAAGGGCAAGGGCTTCGAGGTGGTGCGC
AGCTCGAGGATGCCGCCCGCCAGCTTCGGCGACGAGACGCCGCCCGAGGGCATCCCCGTGGCCATGGGCGTGCTG
AGGAACGGGCCCATTGACTCGGACGACGATTCGCTCGACAGCCGCAAGAAGCCGAGGAGGCGTCGGCCCGACCAT
CTGTTGACGGACACGGGCGATGCGCAGTCTGTGGACGCTAGCGGGCCGGATAGTCCTTCCCCTGGAGGATGA
Transcript >Ophun1|2391
ATGCGTCGACGAGAGGGGACGACGATAACGACGACGACGAAGACCAAGACCAAGACGACGATAGACGACGACGAC
GTCCCCAGACGCCACCGCCCTCTCTTCTCATCGCCGCGCCACAACCTCCCTGAAAGACGCTCGGCTCGCGCCCGC
CCCGCCAGCACCCTCCTCGTCATCACCCTCACCCTCCTCACCCTCCTCCTCCTCTCAGCCTCTCCCGCATCAGCA
GCACGCGTCCCCGTGGCCTCGTGCCTGAGCTCGGCCCCTTCCCAGCTACAATGGCGCCCGATATACGCCGACGCC
CGCTTCAGCGGCGCAGACAACAACTACCGGCTCGAGCTGGTGGTTTGGGGCAACGTCTCCGGGTCGCTCGACCAG
GCGGCGTCGTTGCCTCCTCCGGGGGATGCGCATTGGACGAGGCCGCAAGAGACGGAGGGCAAGATTGCTGAGTCG
GCGGATAAGCCTGATGTGGAGAGTCGGAAGGCGACGACGTTGATTCGCAAGGTTAATGTCTTGACCACCGCTCCT
CGCGGCCTCCTCCCCTCGGTTAACCTCAGCCACGACTTCTTCTCTCCCTACTCCTTCGCCTCCTTCGCCCCGACC
ATCCGCATCATCTATGGCGATGCAAAGAAAACGAACGTCGGCTGCATTACCGCCGTCGTCACCCCCGATCTGGCC
TCGGTCGCCTGGCTGCCGCGTTTCCTACCGCTCGTCATCCTCCTCATCTCGGGCCTGGCCGTCGTCTTGGCCGCC
GTCTTCAGCCCCTGGGGCTCAACCAGCATAGTCCACTGGTCGTCCAACTACGGCCGAGACGCCGACCTGCTGCGC
CTCGTCACCCCCGGCTTCGGCGATTGTCTGCAGTACATCCAGTTCGTCGTCCTCACTGGCGCCCTCTCCCTCAGC
TACCCGGGCTACTACCAGCCCGTCGTCGCCCAGGCCGCCTGGTCGGCTCTCATTTTCAACCAGAGCGTCGTCACC
GGTGCGCCCTCGTGGCAGAGCGTCGTCGACGGCATCTACGTCACAAACAGCTCCGACGGTTATGGCCTGCAGCAG
CTCGGCCAGCTCGCCGGCATGGCCCGCAGCGCCGACGTCTGGCCGGGATTCATGGTCTGGCTGGGCGTCATCCTC
GTCGGCCTCTTCGTCGCGATCCAGACTGGATTTCTTGCTCGCTGGCTCTGGAGGAGGCTCAACCACATCCCCGAG
GAGGACCTGCGGGCCAAGAACGTGCCCTTTACCGTCGGTAACCTCGTCCGCGCCGTCTTCAACTACATGCTCGTC
CCCATCGTTGCCCTCTCGTGCTTCCAGCTCGTCGTCGCCCGCTCTTCTCCCGCCTTTACCGTCGCCCTCGCCGTT
CTGACGCTCGTCTTGCTCCTCGTCTCAGCCGCCTGGATGCTGGCCCTCGTCATCCGCACTCGGCCCAAGTCGGTC
CTCTTCGACGACCTGCCCACGCTCCTGCGCATCGGGCCCCTCTACAACACCTACTCGGACCAGGTGGCCGCCTTT
GCTCTCATCCCCGTCGTCCTCAACCTGATGCGCGGCATCGCCATCGGCGCCGTTCAGCCCAGCGGCGTCGCTCAG
ATCGTTCTGCTCGCCATCTGCGAGGTCATCCAGGTCTTTACCCTCCACGCCTTCCGCCCCTTTCCCGCTCCCACG
TCCATGAACGCCTATCACACCGTCTTCTCCTTACTGAGGGCCATCACCCTGCTGCTCATGGTGGCCTTTGTCCCC
AGCCTGGGCGTCGCCGAGGGCCGCAAGTGCTGGATCGGATACGCCATCCTACTCATCCACGCCGCCGTCCTCGTC
CTCGGTTTCTTTCTCTCGGCGCTCAAGACCATGGTCGAGGTGCTGGCCCGTCTACTCGGTGCCGGCGGCGATGAC
CACGTCGGTCTACGTCGCGGTGGCCTCTCCAAGATATTCGGAATGCGCCAGCTCTCGAGGCGAGAGACGCACCGT
CCGGGTATCTCGCGCGCCAGTCACTTGTCGACGGCCGCCATCTTGGAGATGGAGGACGGCAGCAGAGCCCCGGCC
GGAAGCAGGATTCGGTCCGTCTCGACGGCCAGCCTCTCCCAGCACCTCTCCCACAACCAGAACCTCCACCATCGA
CAGCGGAGCAGCTCGGCGCTCGACAGCATCGATCTCTACGCCAGCGTCGGATCGCGAAACGCCGATCACTCCGTC
AGCGGCGTCTCGTACGCGCCCGGCGAGACGGCCTTTTCCTTCCTGGCATCGCCGCGCCAGGCCGTCTCCCCCGCC
GCCGCCGCCGTCGAGACTGCTGACCCGTACTATCGCCCTCCTCGGCGGCGGCGAGATACGCTGGGCGCCGGAGAC
GCCCCCTACACGGACGCGCCCCGCGCCGGCGAGGTCGAGCCGAAGCAGCCGATTCAAGGCTCCGGCGCCGGCTTG
TCGGGCGAAGTGGCCCTCGAGCTCCCGGAGGAGGCGGCCCGGGGCGCTACGACGACGCAGCTGCCGCTCAACGCC
GTCACGATGGATTTCCCGCCTAACCGTCCGGATTACGCGACGCGCGAGGTCGACTTTTACTACGGCGTTCGCGGA
CCGGCTCTCAACTCGGTCGGTCCCGGCAGGAAGCTGGGGACGGGGCCGGCGGATCCGACGGGGCCCGTTGCCACC
GCCACCGGCTGGTTCCGCAACATGTTCAAGGGCAAGAAGACCAAGGAAAAGGGCAAGGGCTTCGAGGTGGTGCGC
AGCTCGAGGATGCCGCCCGCCAGCTTCGGCGACGAGACGCCGCCCGAGGGCATCCCCGTGGCCATGGGCGTGCTG
AGGAACGGGCCCATTGACTCGGACGACGATTCGCTCGACAGCCGCAAGAAGCCGAGGAGGCGTCGGCCCGACCAT
CTGTTGACGGACACGGGCGATGCGCAGTCTGTGGACGCTAGCGGGCCGGATAGTCCTTCCCCTGGAGGATGA
Gene >Ophun1|2391
ATGCGTCGACGAGAGGGGACGACGATAACGACGACGACGAAGACCAAGACCAAGACGACGATAGACGACGACGAC
GTCCCCAGACGCCACCGCCCTCTCTTCTCATCGCCGCGCCACAACCTCCCTGAAAGACGCTCGGCTCGCGCCCGC
CCCGCCAGCACCCTCCTCGTCATCACCCTCACCCTCCTCACCCTCCTCCTCCTCTCAGCCTCTCCCGCATCAGCA
GCACGCGTCCCCGTGGCCTCGTGCCTGAGCTCGGCCCCTTCCCAGCTACAATGGCGCCCGATATACGCCGACGCC
CGCTTCAGCGGCGCAGACAACAACTACCGGCTCGAGCTGGTGGTTTGGGGCAACGTCTCCGGGTCGCTCGACCAG
GCGGCGTCGTTGCCTCCTCCGGGGGATGCGCATTGGACGAGGCCGCAAGAGACGGAGGGCAAGATTGCTGAGTCG
GCGGATAAGCCTGATGTGGAGAGTCGGAAGGCGACGACGTTGATTCGCAAGGTTAATGTCTTGACGTATGAGGTT
TGGGAGGATGAGCCGGTGAGCTTTTGCAAGACGGGGCTTGTCAATGGGTCGTGTCCCTTGGGGCCGGTCTTTGAC
GATAGGGCGCTGTACGGAGTCCTCTCTCTTCTTCTTCGTCTTATATCTACTGACGATGAGGCATAGCACCGCTCC
TCGCGGCCTCCTCCCCTCGGTTAACCTCAGCCACGACTTCTTCTCTCCCTACTCCTTCGCCTCCTTCGCCCCGAC
CATCCGCATCATCTATGGCGATGCAAAGAAAACGAACGTCGGCTGCATTACCGCCGTCGTCACCCCCGATCTGGC
CTCGGTCGCCTGGCTGCCGCGTTTCCTACCGCTCGTCATCCTCCTCATCTCGGGCCTGGCCGTCGTCTTGGCCGC
CGTCTTCAGCCCCTGGGGCTCAACCAGCATAGTCCACTGGTCGTCCAACTACGGCCGAGACGCCGACCTGCTGCG
CCTCGTCACCCCCGGCTTCGGCGATTGTCTGCAGTACATCCAGTTCGTCGTCCTCACTGGCGCCCTCTCCCTCAG
CTACCCGGGCTACTACCAGCCCGTCGTCGCCCAGGCCGCCTGGTCGGCTCTCATTTTCAACCAGAGCGTCGTCAC
CGGTGCGCCCTCGTGGCAGAGCGTCGTCGACGGCATCTACGTCACAAACAGCTCCGACGGTTATGGCCTGCAGCA
GCTCGGCCAGCTCGCCGGCATGGCCCGCAGCGCCGACGTCTGGCCGGGATTCATGGTCTGGCTGGGCGTCATCCT
CGTCGGCCTCTTCGTCGCGATCCAGACTGGATTTCTTGCTCGCTGGCTCTGGAGGAGGCTCAACCACATCCCCGA
GGAGGACCTGCGGGCCAAGAACGTGCCCTTTACCGTCGGTAACCTCGTCCGCGCCGTCTTCAACTACATGCTCGT
CCCCATCGTTGCCCTCTCGTGCTTCCAGCTCGTCGTCGCCCGCTCTTCTCCCGCCTTTACCGTCGCCCTCGCCGT
TCTGACGCTCGTCTTGCTCCTCGTCTCAGCCGCCTGGATGCTGGCCCTCGTCATCCGCACTCGGCCCAAGTCGGT
CCTCTTCGACGACCTGCCCACGCTCCTGCGCATCGGGCCCCTCTACAACACCTACTCGGACCAGGTGGCCGCCTT
TGCTCTCATCCCCGTCGTCCTCAACCTGATGCGCGGCATCGCCATCGGCGCCGTTCAGCCCAGCGGCGTCGCTCA
GATCGTTCTGCTCGCCATCTGCGAGGTCATCCAGGTCTTTACCCTCCACGCCTTCCGCCCCTTTCCCGCTCCCAC
GTCCATGAACGCCTATCACACCGTCTTCTCCTTACTGAGGGCCATCACCCTGCTGCTCATGGTGGCCTTTGTCCC
CAGCCTGGGCGTCGCCGAGGGCCGCAAGTGCTGGATCGGATACGCCATCCTACTCATCCACGCCGCCGTCCTCGT
CCTCGGTTTCTTTCTCTCGGCGCTCAAGACCATGGTCGAGGTGCTGGCCCGTCTACTCGGTGCCGGCGGCGATGA
CCACGTCGGTCTACGTCGCGGTGGCCTCTCCAAGATATTCGGAATGCGCCAGCTCTCGAGGCGAGAGACGCACCG
TCCGGGTATCTCGCGCGCCAGTCACTTGTCGACGGCCGCCATCTTGGAGATGGAGGACGGCAGCAGAGCCCCGGC
CGGAAGCAGGATTCGGTCCGTCTCGACGGCCAGCCTCTCCCAGCACCTCTCCCACAACCAGAACCTCCACCATCG
ACAGCGGAGCAGCTCGGCGCTCGACAGCATCGATCTCTACGCCAGCGTCGGATCGCGAAACGCCGATCACTCCGT
CAGCGGCGTCTCGTACGCGCCCGGCGAGACGGCCTTTTCCTTCCTGGCATCGCCGCGCCAGGCCGTCTCCCCCGC
CGCCGCCGCCGTCGAGACTGCTGACCCGTACTATCGCCCTCCTCGGCGGCGGCGAGATACGCTGGGCGCCGGAGA
CGCCCCCTACACGGACGCGCCCCGCGCCGGCGAGGTCGAGCCGAAGCAGCCGATTCAAGGCTCCGGCGCCGGCTT
GTCGGGCGAAGTGGCCCTCGAGCTCCCGGAGGAGGCGGCCCGGGGCGCTACGACGACGCAGCTGCCGCTCAACGC
CGTCACGATGGATTTCCCGCCTAACCGTCCGGATTACGCGACGCGCGAGGTCGACTTTTACTACGGCGTTCGCGG
ACCGGCTCTCAACTCGGTCGGTCCCGGCAGGAAGCTGGGGACGGGGCCGGCGGATCCGACGGGGCCCGTTGCCAC
CGCCACCGGCTGGTTCCGCAACATGTTCAAGGGCAAGAAGACCAAGGAAAAGGGCAAGGGCTTCGAGGTGGTGCG
CAGCTCGAGGATGCCGCCCGCCAGCTTCGGCGACGAGACGCCGCCCGAGGGCATCCCCGTGGCCATGGGCGTGCT
GAGGAACGGGCCCATTGACTCGGACGACGATTCGCTCGACAGCCGCAAGAAGCCGAGGAGGCGTCGGCCCGACCA
TCTGTTGACGGACACGGGCGATGCGCAGTCTGTGGACGCTAGCGGGCCGGATAGTCCTGTCGAGGGGGGGGCGGG
ACGGGCCGGGGAAGACGGGACGGGCCGGTTGATCAGTCCCCTGGAGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail