Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2387
Gene name
LocationContig_218:10227..12226
Strand-
Gene length (bp)1999
Transcript length (bp)1770
Coding sequence length (bp)1770
Protein length (aa) 590

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01545 Cation_efflux Cation efflux family 3.0E-21 299 492
PF16916 ZT_dimer Dimerisation domain of Zinc Transporter 1.3E-06 514 573

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5NA18|MTP5_ORYSJ Metal tolerance protein 5 OS=Oryza sativa subsp. japonica GN=MTP5 PE=2 SV=1 277 582 4.0E-50
sp|Q6Z7K5|MTP3_ORYSJ Metal tolerance protein 3 OS=Oryza sativa subsp. japonica GN=MTP3 PE=2 SV=1 286 582 8.0E-50
sp|Q10PP8|MTP4_ORYSJ Metal tolerance protein 4 OS=Oryza sativa subsp. japonica GN=MTP4 PE=2 SV=1 298 582 1.0E-48
sp|Q9LDU0|MTP7_ORYSJ Metal tolerance protein 7 OS=Oryza sativa subsp. japonica GN=MTP7 PE=2 SV=1 297 582 6.0E-48
sp|Q9M2P2|MTPC3_ARATH Putative metal tolerance protein C3 OS=Arabidopsis thaliana GN=MTPC3 PE=3 SV=2 297 582 1.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5NA18|MTP5_ORYSJ Metal tolerance protein 5 OS=Oryza sativa subsp. japonica GN=MTP5 PE=2 SV=1 277 582 4.0E-50
sp|Q6Z7K5|MTP3_ORYSJ Metal tolerance protein 3 OS=Oryza sativa subsp. japonica GN=MTP3 PE=2 SV=1 286 582 8.0E-50
sp|Q10PP8|MTP4_ORYSJ Metal tolerance protein 4 OS=Oryza sativa subsp. japonica GN=MTP4 PE=2 SV=1 298 582 1.0E-48
sp|Q9LDU0|MTP7_ORYSJ Metal tolerance protein 7 OS=Oryza sativa subsp. japonica GN=MTP7 PE=2 SV=1 297 582 6.0E-48
sp|Q9M2P2|MTPC3_ARATH Putative metal tolerance protein C3 OS=Arabidopsis thaliana GN=MTPC3 PE=3 SV=2 297 582 1.0E-46
sp|Q9SAJ7|MTP9_ARATH Metal tolerance protein 9 OS=Arabidopsis thaliana GN=MTP9 PE=2 SV=2 297 585 7.0E-45
sp|Q0WU02|MTP10_ARATH Metal tolerance protein 10 OS=Arabidopsis thaliana GN=MTP10 PE=2 SV=1 297 582 1.0E-43
sp|O80632|MTP11_ARATH Metal tolerance protein 11 OS=Arabidopsis thaliana GN=MTP11 PE=2 SV=1 277 582 4.0E-42
sp|Q0DHJ5|MTP6_ORYSJ Metal tolerance protein 6 OS=Oryza sativa subsp. japonica GN=MTP6 PE=2 SV=2 277 582 3.0E-36
sp|Q08970|MMT2_YEAST Mitochondrial metal transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMT2 PE=3 SV=2 300 501 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0006812 cation transport Yes
GO:0008324 cation transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0006811 ion transport No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0005215 transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 296 318 22
2 366 388 22
3 403 425 22
4 446 465 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2387
MASPVSSKPRPIRRPSLLSLDEHYPLTTRTGALASLIRNRSSHQSLAGSWPPAHRHHAADDEEARHDDDDIERLL
RDGTRLSQILKGPQVRSMNLIGKSNPRYRWDSYWKNDDELKLMDKTLRHYYRRTNDLIQQYMYIDCLLDSSIPHD
LLNEYSAELEASAFRPIDVPPTITEEPTVASSLATSHEPSYGSVSPPTSSLPTLPQKRTPKDIFRSSESMPLLVH
DDESIDEDDDDDEQGHDQGHGQDDADARNKMRNDARHPSAPRTPQSADDGPRPFLPWLEDGDVESDDPVVTVAIW
INLVANLVLLIGKIVVIVSVPSMSVLASLVDATLDFLSTAIVWTTTRLISSGQKDQYRYPVGRRRLEPLGVLVFS
VIMVTSFVQVALQCMQRLLSPDHQILQLSVPAIVILVSTVVIKGACWLWCRLIKNSGVRALAEDAKTDVIFNLGS
IFFPIVGFYGRIWWLDALGGLLLSFIVIITWSQTSAHHVRNLTGHSAEPDERNLLLYLTMRFATAIRQIQNLRAY
HAGDKLFVEVDIVLSASTPLKDSHDLSEVLTYFLESVPIVDRAFVHVDYTSYNAPTHISKQSSD*
Coding >Ophun1|2387
ATGGCCTCCCCCGTGTCGTCGAAACCGCGTCCCATCCGCAGGCCATCGCTCCTCTCGCTGGACGAGCATTACCCG
CTGACGACGCGTACCGGAGCTCTCGCGTCTCTGATCCGCAACCGCTCTTCGCATCAGAGTCTGGCCGGCTCGTGG
CCCCCGGCTCATCGGCATCATGCGGCTGATGATGAGGAGGCGCGGCACGACGACGATGACATCGAGAGGCTGCTC
CGCGATGGCACGCGGCTTAGCCAGATCCTCAAGGGTCCGCAGGTCCGCAGCATGAATCTGATTGGCAAGAGCAAT
CCCCGGTATCGGTGGGATTCGTACTGGAAGAACGACGACGAGCTCAAGCTCATGGACAAGACGCTACGTCACTAC
TACCGCCGCACCAACGACCTCATCCAGCAGTACATGTACATCGACTGTCTCCTCGACTCCTCCATCCCACACGAC
CTCCTCAACGAATACTCAGCCGAGCTCGAAGCCTCAGCCTTCCGTCCCATCGACGTCCCTCCCACCATAACAGAG
GAACCAACAGTCGCGTCATCGCTCGCCACCTCTCACGAGCCCTCGTACGGGTCCGTGTCGCCGCCGACGTCTTCC
TTACCGACGCTCCCTCAGAAACGCACGCCAAAGGACATCTTCCGCTCGTCAGAGAGCATGCCACTGCTCGTCCAC
GACGATGAAAGCATCGACGAAGATGACGACGATGACGAACAAGGTCATGATCAAGGCCACGGCCAAGACGACGCA
GACGCAAGGAACAAGATGCGCAACGACGCCCGCCACCCTTCCGCCCCGCGCACCCCCCAAAGCGCAGACGACGGA
CCGAGACCCTTCCTCCCCTGGCTCGAAGACGGCGACGTAGAAAGCGACGATCCCGTCGTCACCGTCGCCATCTGG
ATCAATCTCGTCGCCAACCTCGTCCTCCTCATCGGCAAGATTGTCGTCATCGTCTCCGTCCCCTCCATGTCGGTG
CTTGCCAGCCTCGTCGACGCCACGCTCGATTTCCTCAGCACCGCCATCGTCTGGACGACAACCCGGCTGATCTCA
TCCGGTCAGAAGGATCAATACCGCTACCCCGTCGGCCGTCGCCGCCTGGAACCCCTCGGCGTCCTCGTCTTCTCC
GTCATCATGGTGACGAGCTTCGTGCAGGTTGCGCTCCAGTGCATGCAGCGCCTGCTAAGCCCCGATCACCAGATC
CTCCAGCTCAGCGTGCCGGCCATCGTCATTCTCGTCAGCACCGTCGTCATCAAGGGCGCCTGCTGGCTCTGGTGC
CGGCTCATCAAGAACTCGGGTGTGCGAGCCTTAGCAGAAGACGCCAAAACAGACGTCATCTTCAACCTCGGCTCC
ATCTTCTTCCCCATCGTCGGCTTCTACGGCCGCATCTGGTGGCTCGACGCCCTAGGCGGCCTCCTCCTCTCCTTC
ATCGTCATCATCACCTGGAGCCAAACCTCAGCCCACCACGTCCGCAACCTGACCGGCCACTCCGCCGAGCCCGAC
GAGCGCAACCTCCTCCTCTACCTAACCATGCGCTTCGCCACCGCCATCCGCCAAATCCAAAACCTACGCGCCTAC
CACGCAGGCGATAAGCTCTTCGTAGAGGTCGACATCGTCCTCTCCGCCAGCACGCCCCTCAAGGACAGCCATGAC
CTCAGCGAGGTGCTCACCTACTTCCTCGAGTCGGTGCCCATCGTCGACAGGGCGTTTGTGCACGTCGATTACACG
AGCTACAACGCGCCCACGCATATCTCCAAGCAGTCGTCTGACTAG
Transcript >Ophun1|2387
ATGGCCTCCCCCGTGTCGTCGAAACCGCGTCCCATCCGCAGGCCATCGCTCCTCTCGCTGGACGAGCATTACCCG
CTGACGACGCGTACCGGAGCTCTCGCGTCTCTGATCCGCAACCGCTCTTCGCATCAGAGTCTGGCCGGCTCGTGG
CCCCCGGCTCATCGGCATCATGCGGCTGATGATGAGGAGGCGCGGCACGACGACGATGACATCGAGAGGCTGCTC
CGCGATGGCACGCGGCTTAGCCAGATCCTCAAGGGTCCGCAGGTCCGCAGCATGAATCTGATTGGCAAGAGCAAT
CCCCGGTATCGGTGGGATTCGTACTGGAAGAACGACGACGAGCTCAAGCTCATGGACAAGACGCTACGTCACTAC
TACCGCCGCACCAACGACCTCATCCAGCAGTACATGTACATCGACTGTCTCCTCGACTCCTCCATCCCACACGAC
CTCCTCAACGAATACTCAGCCGAGCTCGAAGCCTCAGCCTTCCGTCCCATCGACGTCCCTCCCACCATAACAGAG
GAACCAACAGTCGCGTCATCGCTCGCCACCTCTCACGAGCCCTCGTACGGGTCCGTGTCGCCGCCGACGTCTTCC
TTACCGACGCTCCCTCAGAAACGCACGCCAAAGGACATCTTCCGCTCGTCAGAGAGCATGCCACTGCTCGTCCAC
GACGATGAAAGCATCGACGAAGATGACGACGATGACGAACAAGGTCATGATCAAGGCCACGGCCAAGACGACGCA
GACGCAAGGAACAAGATGCGCAACGACGCCCGCCACCCTTCCGCCCCGCGCACCCCCCAAAGCGCAGACGACGGA
CCGAGACCCTTCCTCCCCTGGCTCGAAGACGGCGACGTAGAAAGCGACGATCCCGTCGTCACCGTCGCCATCTGG
ATCAATCTCGTCGCCAACCTCGTCCTCCTCATCGGCAAGATTGTCGTCATCGTCTCCGTCCCCTCCATGTCGGTG
CTTGCCAGCCTCGTCGACGCCACGCTCGATTTCCTCAGCACCGCCATCGTCTGGACGACAACCCGGCTGATCTCA
TCCGGTCAGAAGGATCAATACCGCTACCCCGTCGGCCGTCGCCGCCTGGAACCCCTCGGCGTCCTCGTCTTCTCC
GTCATCATGGTGACGAGCTTCGTGCAGGTTGCGCTCCAGTGCATGCAGCGCCTGCTAAGCCCCGATCACCAGATC
CTCCAGCTCAGCGTGCCGGCCATCGTCATTCTCGTCAGCACCGTCGTCATCAAGGGCGCCTGCTGGCTCTGGTGC
CGGCTCATCAAGAACTCGGGTGTGCGAGCCTTAGCAGAAGACGCCAAAACAGACGTCATCTTCAACCTCGGCTCC
ATCTTCTTCCCCATCGTCGGCTTCTACGGCCGCATCTGGTGGCTCGACGCCCTAGGCGGCCTCCTCCTCTCCTTC
ATCGTCATCATCACCTGGAGCCAAACCTCAGCCCACCACGTCCGCAACCTGACCGGCCACTCCGCCGAGCCCGAC
GAGCGCAACCTCCTCCTCTACCTAACCATGCGCTTCGCCACCGCCATCCGCCAAATCCAAAACCTACGCGCCTAC
CACGCAGGCGATAAGCTCTTCGTAGAGGTCGACATCGTCCTCTCCGCCAGCACGCCCCTCAAGGACAGCCATGAC
CTCAGCGAGGTGCTCACCTACTTCCTCGAGTCGGTGCCCATCGTCGACAGGGCGTTTGTGCACGTCGATTACACG
AGCTACAACGCGCCCACGCATATCTCCAAGCAGTCGTCTGACTAG
Gene >Ophun1|2387
ATGGCCTCCCCCGTGTCGTCGAAACCGCGTCCCATCCGCAGGCCATCGCTCCTCTCGCTGGACGAGCATTACCCG
CTGACGACGCGTACCGGAGCTCTCGCGTCTCTGATCCGCAACCGCTCTTCGCATCAGAGTCTGGCCGGCTCGTGG
CCCCCGGCTCATCGGCATCATGCGGCTGATGATGAGGAGGCGCGGCACGACGACGATGACATCGAGAGGCTGCTC
CGCGATGGCACGCGGCTTAGCCAGATCCTCAAGGGTCCGCAGGTCCGCAGCATGAATCTGATTGGCAAGAGCAAT
CCCCGGTATCGGTGGGATTCGTACTGGAAGAACGACGACGAGCTCAAGCTCATGGACAAGACGCTGTGAGCCGCT
GTCACGCTCCAATCAAGATGGGGAAAACGCTCACCGGTACCACCATCCAGACGTCACTACTACCGCCGCACCAAC
GACCTCATCCAGCAGTACATGTACATCGACTGTCTCCTCGACTCCTCCATCCCACACGACCTCCTCAACGAATAC
TCAGCCGAGCTCGAAGCCTCAGCCTTCCGTCCCATCGACGTCCCTCCCACCATAACAGAGGAACCAACAGTCGCG
TCATCGCTCGCCACCTCTCACGAGCCCTCGTACGGGTCCGTGTCGCCGCCGACGTCTTCCTTACCGACGCTCCCT
CAGAAACGCACGCCAAAGGACATCTTCCGCTCGTCAGAGAGCATGCCACTGCTCGTCCACGACGATGAAAGCATC
GACGAAGATGACGACGATGACGAACAAGGTCATGATCAAGGCCACGGCCAAGACGACGCAGACGCAAGGAACAAG
ATGCGCAACGACGCCCGCCACCCTTCCGCCCCGCGCACCCCCCAAAGCGCAGACGACGGACCGAGACCCTTCCTC
CCCTGGCTCGAAGACGGCGACGTAGAAAGCGACGATCCCGTCGTCACCGTCGCCATCTGGATCAATCTCGTCGCC
AACCTCGTCCTCCTCATCGGCAAGATTGTCGTCATCGTCTCCGTCCCCTCCATGTCGGTGCTTGCCAGCCTCGTC
GACGCCACGCTCGATTTCCTCAGCACCGCCATCGTCTGGACGACAACCCGGCTGATCTCATCCGGTCAGAAGGAT
CAATACCGCTACCCCGTCGGCCGTCGCCGGTGAGTTTCAAAACTCCCCATTTCCCTCTCCCTGACCCCCTTCTGA
TACTCTGCCATCAGCCTGGAACCCCTCGGCGTCCTCGTCTTCTCCGTCATCATGGTGACGAGCTTCGTGCAGGTT
GCGCTCCAGTGCATGCAGCGCCTGCTAAGCCCCGATCACCAGATCCTCCAGCTCAGCGTGCCGGCCATCGTCATT
CTCGTCAGCACCGTCGTCATCAAGGGCGCCTGCTGGCTCTGGTGCCGGCTCATCAAGAACTCGGGTGTGCGAGCC
TTGTAAGCACATCATCCCCATACTTCTCTTGTCCTTATCCCACTGACGCCCCAGCAGAGCAGAAGACGCCAAAAC
AGACGTCATCTTCAACCTCGGCTCCATCTTCTTCCCCATCGGTAACTCCCCCTTCCCCCTTCTCCCCTCACCAAC
CCCATCACTGACCAACCCAGTCGGCTTCTACGGCCGCATCTGGTGGCTCGACGCCCTAGGCGGCCTCCTCCTCTC
CTTCATCGTCATCATCACCTGGAGCCAAACCTCAGCCCACCACGTCCGCAACCTGACCGGCCACTCCGCCGAGCC
CGACGAGCGCAACCTCCTCCTCTACCTAACCATGCGCTTCGCCACCGCCATCCGCCAAATCCAAAACCTACGCGC
CTACCACGCAGGCGATAAGCTCTTCGTAGAGGTCGACATCGTCCTCTCCGCCAGCACGCCCCTCAAGGACAGCCA
TGACCTCAGCGAGGTGCTCACCTACTTCCTCGAGTCGGTGCCCATCGTCGACAGGGCGTTTGTGCACGTCGATTA
CACGAGCTACAACGCGCCCACGCATATCTCCAAGCAGTCGTCTGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail