Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2387
Gene name
LocationContig_218:10227..12226
Strand-
Gene length (bp)1999
Transcript length (bp)1770
Coding sequence length (bp)1770
Protein length (aa) 590

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01545 Cation_efflux Cation efflux family 3.0E-21 299 492
PF16916 ZT_dimer Dimerisation domain of Zinc Transporter 1.3E-06 514 573

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5NA18|MTP5_ORYSJ Metal tolerance protein 5 OS=Oryza sativa subsp. japonica GN=MTP5 PE=2 SV=1 277 582 4.0E-50
sp|Q6Z7K5|MTP3_ORYSJ Metal tolerance protein 3 OS=Oryza sativa subsp. japonica GN=MTP3 PE=2 SV=1 286 582 8.0E-50
sp|Q10PP8|MTP4_ORYSJ Metal tolerance protein 4 OS=Oryza sativa subsp. japonica GN=MTP4 PE=2 SV=1 298 582 1.0E-48
sp|Q9LDU0|MTP7_ORYSJ Metal tolerance protein 7 OS=Oryza sativa subsp. japonica GN=MTP7 PE=2 SV=1 297 582 6.0E-48
sp|Q9M2P2|MTPC3_ARATH Putative metal tolerance protein C3 OS=Arabidopsis thaliana GN=MTPC3 PE=3 SV=2 297 582 1.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5NA18|MTP5_ORYSJ Metal tolerance protein 5 OS=Oryza sativa subsp. japonica GN=MTP5 PE=2 SV=1 277 582 4.0E-50
sp|Q6Z7K5|MTP3_ORYSJ Metal tolerance protein 3 OS=Oryza sativa subsp. japonica GN=MTP3 PE=2 SV=1 286 582 8.0E-50
sp|Q10PP8|MTP4_ORYSJ Metal tolerance protein 4 OS=Oryza sativa subsp. japonica GN=MTP4 PE=2 SV=1 298 582 1.0E-48
sp|Q9LDU0|MTP7_ORYSJ Metal tolerance protein 7 OS=Oryza sativa subsp. japonica GN=MTP7 PE=2 SV=1 297 582 6.0E-48
sp|Q9M2P2|MTPC3_ARATH Putative metal tolerance protein C3 OS=Arabidopsis thaliana GN=MTPC3 PE=3 SV=2 297 582 1.0E-46
sp|Q9SAJ7|MTP9_ARATH Metal tolerance protein 9 OS=Arabidopsis thaliana GN=MTP9 PE=2 SV=2 297 585 7.0E-45
sp|Q0WU02|MTP10_ARATH Metal tolerance protein 10 OS=Arabidopsis thaliana GN=MTP10 PE=2 SV=1 297 582 1.0E-43
sp|O80632|MTP11_ARATH Metal tolerance protein 11 OS=Arabidopsis thaliana GN=MTP11 PE=2 SV=1 277 582 4.0E-42
sp|Q0DHJ5|MTP6_ORYSJ Metal tolerance protein 6 OS=Oryza sativa subsp. japonica GN=MTP6 PE=2 SV=2 277 582 3.0E-36
sp|Q08970|MMT2_YEAST Mitochondrial metal transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMT2 PE=3 SV=2 300 501 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0006812 cation transport Yes
GO:0008324 cation transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0006811 ion transport No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0005215 transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 296 318 22
2 366 388 22
3 403 425 22
4 446 465 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1890
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5607
Ophiocordyceps australis map64 (Brazil) OphauB2|5440
Ophiocordyceps camponoti-floridani Ophcf2|07384
Ophiocordyceps camponoti-rufipedis Ophun1|2387 (this protein)
Ophiocordyceps kimflemingae Ophio5|686
Ophiocordyceps subramaniannii Hirsu2|1946

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2387
MASPVSSKPRPIRRPSLLSLDEHYPLTTRTGALASLIRNRSSHQSLAGSWPPAHRHHAADDEEARHDDDDIERLL
RDGTRLSQILKGPQVRSMNLIGKSNPRYRWDSYWKNDDELKLMDKTLRHYYRRTNDLIQQYMYIDCLLDSSIPHD
LLNEYSAELEASAFRPIDVPPTITEEPTVASSLATSHEPSYGSVSPPTSSLPTLPQKRTPKDIFRSSESMPLLVH
DDESIDEDDDDDEQGHDQGHGQDDADARNKMRNDARHPSAPRTPQSADDGPRPFLPWLEDGDVESDDPVVTVAIW
INLVANLVLLIGKIVVIVSVPSMSVLASLVDATLDFLSTAIVWTTTRLISSGQKDQYRYPVGRRRLEPLGVLVFS
VIMVTSFVQVALQCMQRLLSPDHQILQLSVPAIVILVSTVVIKGACWLWCRLIKNSGVRALAEDAKTDVIFNLGS
IFFPIVGFYGRIWWLDALGGLLLSFIVIITWSQTSAHHVRNLTGHSAEPDERNLLLYLTMRFATAIRQIQNLRAY
HAGDKLFVEVDIVLSASTPLKDSHDLSEVLTYFLESVPIVDRAFVHVDYTSYNAPTHISKQSSD*
Coding >Ophun1|2387
ATGGCCTCCCCCGTGTCGTCGAAACCGCGTCCCATCCGCAGGCCATCGCTCCTCTCGCTGGACGAGCATTACCCG
CTGACGACGCGTACCGGAGCTCTCGCGTCTCTGATCCGCAACCGCTCTTCGCATCAGAGTCTGGCCGGCTCGTGG
CCCCCGGCTCATCGGCATCATGCGGCTGATGATGAGGAGGCGCGGCACGACGACGATGACATCGAGAGGCTGCTC
CGCGATGGCACGCGGCTTAGCCAGATCCTCAAGGGTCCGCAGGTCCGCAGCATGAATCTGATTGGCAAGAGCAAT
CCCCGGTATCGGTGGGATTCGTACTGGAAGAACGACGACGAGCTCAAGCTCATGGACAAGACGCTACGTCACTAC
TACCGCCGCACCAACGACCTCATCCAGCAGTACATGTACATCGACTGTCTCCTCGACTCCTCCATCCCACACGAC
CTCCTCAACGAATACTCAGCCGAGCTCGAAGCCTCAGCCTTCCGTCCCATCGACGTCCCTCCCACCATAACAGAG
GAACCAACAGTCGCGTCATCGCTCGCCACCTCTCACGAGCCCTCGTACGGGTCCGTGTCGCCGCCGACGTCTTCC
TTACCGACGCTCCCTCAGAAACGCACGCCAAAGGACATCTTCCGCTCGTCAGAGAGCATGCCACTGCTCGTCCAC
GACGATGAAAGCATCGACGAAGATGACGACGATGACGAACAAGGTCATGATCAAGGCCACGGCCAAGACGACGCA
GACGCAAGGAACAAGATGCGCAACGACGCCCGCCACCCTTCCGCCCCGCGCACCCCCCAAAGCGCAGACGACGGA
CCGAGACCCTTCCTCCCCTGGCTCGAAGACGGCGACGTAGAAAGCGACGATCCCGTCGTCACCGTCGCCATCTGG
ATCAATCTCGTCGCCAACCTCGTCCTCCTCATCGGCAAGATTGTCGTCATCGTCTCCGTCCCCTCCATGTCGGTG
CTTGCCAGCCTCGTCGACGCCACGCTCGATTTCCTCAGCACCGCCATCGTCTGGACGACAACCCGGCTGATCTCA
TCCGGTCAGAAGGATCAATACCGCTACCCCGTCGGCCGTCGCCGCCTGGAACCCCTCGGCGTCCTCGTCTTCTCC
GTCATCATGGTGACGAGCTTCGTGCAGGTTGCGCTCCAGTGCATGCAGCGCCTGCTAAGCCCCGATCACCAGATC
CTCCAGCTCAGCGTGCCGGCCATCGTCATTCTCGTCAGCACCGTCGTCATCAAGGGCGCCTGCTGGCTCTGGTGC
CGGCTCATCAAGAACTCGGGTGTGCGAGCCTTAGCAGAAGACGCCAAAACAGACGTCATCTTCAACCTCGGCTCC
ATCTTCTTCCCCATCGTCGGCTTCTACGGCCGCATCTGGTGGCTCGACGCCCTAGGCGGCCTCCTCCTCTCCTTC
ATCGTCATCATCACCTGGAGCCAAACCTCAGCCCACCACGTCCGCAACCTGACCGGCCACTCCGCCGAGCCCGAC
GAGCGCAACCTCCTCCTCTACCTAACCATGCGCTTCGCCACCGCCATCCGCCAAATCCAAAACCTACGCGCCTAC
CACGCAGGCGATAAGCTCTTCGTAGAGGTCGACATCGTCCTCTCCGCCAGCACGCCCCTCAAGGACAGCCATGAC
CTCAGCGAGGTGCTCACCTACTTCCTCGAGTCGGTGCCCATCGTCGACAGGGCGTTTGTGCACGTCGATTACACG
AGCTACAACGCGCCCACGCATATCTCCAAGCAGTCGTCTGACTAG
Transcript >Ophun1|2387
ATGGCCTCCCCCGTGTCGTCGAAACCGCGTCCCATCCGCAGGCCATCGCTCCTCTCGCTGGACGAGCATTACCCG
CTGACGACGCGTACCGGAGCTCTCGCGTCTCTGATCCGCAACCGCTCTTCGCATCAGAGTCTGGCCGGCTCGTGG
CCCCCGGCTCATCGGCATCATGCGGCTGATGATGAGGAGGCGCGGCACGACGACGATGACATCGAGAGGCTGCTC
CGCGATGGCACGCGGCTTAGCCAGATCCTCAAGGGTCCGCAGGTCCGCAGCATGAATCTGATTGGCAAGAGCAAT
CCCCGGTATCGGTGGGATTCGTACTGGAAGAACGACGACGAGCTCAAGCTCATGGACAAGACGCTACGTCACTAC
TACCGCCGCACCAACGACCTCATCCAGCAGTACATGTACATCGACTGTCTCCTCGACTCCTCCATCCCACACGAC
CTCCTCAACGAATACTCAGCCGAGCTCGAAGCCTCAGCCTTCCGTCCCATCGACGTCCCTCCCACCATAACAGAG
GAACCAACAGTCGCGTCATCGCTCGCCACCTCTCACGAGCCCTCGTACGGGTCCGTGTCGCCGCCGACGTCTTCC
TTACCGACGCTCCCTCAGAAACGCACGCCAAAGGACATCTTCCGCTCGTCAGAGAGCATGCCACTGCTCGTCCAC
GACGATGAAAGCATCGACGAAGATGACGACGATGACGAACAAGGTCATGATCAAGGCCACGGCCAAGACGACGCA
GACGCAAGGAACAAGATGCGCAACGACGCCCGCCACCCTTCCGCCCCGCGCACCCCCCAAAGCGCAGACGACGGA
CCGAGACCCTTCCTCCCCTGGCTCGAAGACGGCGACGTAGAAAGCGACGATCCCGTCGTCACCGTCGCCATCTGG
ATCAATCTCGTCGCCAACCTCGTCCTCCTCATCGGCAAGATTGTCGTCATCGTCTCCGTCCCCTCCATGTCGGTG
CTTGCCAGCCTCGTCGACGCCACGCTCGATTTCCTCAGCACCGCCATCGTCTGGACGACAACCCGGCTGATCTCA
TCCGGTCAGAAGGATCAATACCGCTACCCCGTCGGCCGTCGCCGCCTGGAACCCCTCGGCGTCCTCGTCTTCTCC
GTCATCATGGTGACGAGCTTCGTGCAGGTTGCGCTCCAGTGCATGCAGCGCCTGCTAAGCCCCGATCACCAGATC
CTCCAGCTCAGCGTGCCGGCCATCGTCATTCTCGTCAGCACCGTCGTCATCAAGGGCGCCTGCTGGCTCTGGTGC
CGGCTCATCAAGAACTCGGGTGTGCGAGCCTTAGCAGAAGACGCCAAAACAGACGTCATCTTCAACCTCGGCTCC
ATCTTCTTCCCCATCGTCGGCTTCTACGGCCGCATCTGGTGGCTCGACGCCCTAGGCGGCCTCCTCCTCTCCTTC
ATCGTCATCATCACCTGGAGCCAAACCTCAGCCCACCACGTCCGCAACCTGACCGGCCACTCCGCCGAGCCCGAC
GAGCGCAACCTCCTCCTCTACCTAACCATGCGCTTCGCCACCGCCATCCGCCAAATCCAAAACCTACGCGCCTAC
CACGCAGGCGATAAGCTCTTCGTAGAGGTCGACATCGTCCTCTCCGCCAGCACGCCCCTCAAGGACAGCCATGAC
CTCAGCGAGGTGCTCACCTACTTCCTCGAGTCGGTGCCCATCGTCGACAGGGCGTTTGTGCACGTCGATTACACG
AGCTACAACGCGCCCACGCATATCTCCAAGCAGTCGTCTGACTAG
Gene >Ophun1|2387
ATGGCCTCCCCCGTGTCGTCGAAACCGCGTCCCATCCGCAGGCCATCGCTCCTCTCGCTGGACGAGCATTACCCG
CTGACGACGCGTACCGGAGCTCTCGCGTCTCTGATCCGCAACCGCTCTTCGCATCAGAGTCTGGCCGGCTCGTGG
CCCCCGGCTCATCGGCATCATGCGGCTGATGATGAGGAGGCGCGGCACGACGACGATGACATCGAGAGGCTGCTC
CGCGATGGCACGCGGCTTAGCCAGATCCTCAAGGGTCCGCAGGTCCGCAGCATGAATCTGATTGGCAAGAGCAAT
CCCCGGTATCGGTGGGATTCGTACTGGAAGAACGACGACGAGCTCAAGCTCATGGACAAGACGCTGTGAGCCGCT
GTCACGCTCCAATCAAGATGGGGAAAACGCTCACCGGTACCACCATCCAGACGTCACTACTACCGCCGCACCAAC
GACCTCATCCAGCAGTACATGTACATCGACTGTCTCCTCGACTCCTCCATCCCACACGACCTCCTCAACGAATAC
TCAGCCGAGCTCGAAGCCTCAGCCTTCCGTCCCATCGACGTCCCTCCCACCATAACAGAGGAACCAACAGTCGCG
TCATCGCTCGCCACCTCTCACGAGCCCTCGTACGGGTCCGTGTCGCCGCCGACGTCTTCCTTACCGACGCTCCCT
CAGAAACGCACGCCAAAGGACATCTTCCGCTCGTCAGAGAGCATGCCACTGCTCGTCCACGACGATGAAAGCATC
GACGAAGATGACGACGATGACGAACAAGGTCATGATCAAGGCCACGGCCAAGACGACGCAGACGCAAGGAACAAG
ATGCGCAACGACGCCCGCCACCCTTCCGCCCCGCGCACCCCCCAAAGCGCAGACGACGGACCGAGACCCTTCCTC
CCCTGGCTCGAAGACGGCGACGTAGAAAGCGACGATCCCGTCGTCACCGTCGCCATCTGGATCAATCTCGTCGCC
AACCTCGTCCTCCTCATCGGCAAGATTGTCGTCATCGTCTCCGTCCCCTCCATGTCGGTGCTTGCCAGCCTCGTC
GACGCCACGCTCGATTTCCTCAGCACCGCCATCGTCTGGACGACAACCCGGCTGATCTCATCCGGTCAGAAGGAT
CAATACCGCTACCCCGTCGGCCGTCGCCGGTGAGTTTCAAAACTCCCCATTTCCCTCTCCCTGACCCCCTTCTGA
TACTCTGCCATCAGCCTGGAACCCCTCGGCGTCCTCGTCTTCTCCGTCATCATGGTGACGAGCTTCGTGCAGGTT
GCGCTCCAGTGCATGCAGCGCCTGCTAAGCCCCGATCACCAGATCCTCCAGCTCAGCGTGCCGGCCATCGTCATT
CTCGTCAGCACCGTCGTCATCAAGGGCGCCTGCTGGCTCTGGTGCCGGCTCATCAAGAACTCGGGTGTGCGAGCC
TTGTAAGCACATCATCCCCATACTTCTCTTGTCCTTATCCCACTGACGCCCCAGCAGAGCAGAAGACGCCAAAAC
AGACGTCATCTTCAACCTCGGCTCCATCTTCTTCCCCATCGGTAACTCCCCCTTCCCCCTTCTCCCCTCACCAAC
CCCATCACTGACCAACCCAGTCGGCTTCTACGGCCGCATCTGGTGGCTCGACGCCCTAGGCGGCCTCCTCCTCTC
CTTCATCGTCATCATCACCTGGAGCCAAACCTCAGCCCACCACGTCCGCAACCTGACCGGCCACTCCGCCGAGCC
CGACGAGCGCAACCTCCTCCTCTACCTAACCATGCGCTTCGCCACCGCCATCCGCCAAATCCAAAACCTACGCGC
CTACCACGCAGGCGATAAGCTCTTCGTAGAGGTCGACATCGTCCTCTCCGCCAGCACGCCCCTCAAGGACAGCCA
TGACCTCAGCGAGGTGCTCACCTACTTCCTCGAGTCGGTGCCCATCGTCGACAGGGCGTTTGTGCACGTCGATTA
CACGAGCTACAACGCGCCCACGCATATCTCCAAGCAGTCGTCTGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail