Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2381
Gene name
LocationContig_217:22964..26793
Strand+
Gene length (bp)3829
Transcript length (bp)3729
Coding sequence length (bp)3729
Protein length (aa) 1243

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00780 CNH CNH domain 1.6E-70 925 1202
PF15405 PH_5 Pleckstrin homology domain 2.6E-43 767 891
PF00621 RhoGEF RhoGEF domain 2.3E-34 544 729
PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP) 3.5E-14 375 442

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTR5|RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf2 PE=1 SV=1 448 1211 0.0E+00
sp|Q9Y7U6|RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf1 PE=1 SV=1 293 1222 0.0E+00
sp|P51862|ROM2_YEAST RHO1 GDP-GTP exchange protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM2 PE=1 SV=1 456 1225 9.0E-164
sp|P53046|ROM1_YEAST RHO1 GDP-GTP exchange protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM1 PE=1 SV=2 336 1224 2.0E-141
sp|Q9Y7U5|RGF3_SCHPO Rho1 guanine nucleotide exchange factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf3 PE=1 SV=1 466 1182 9.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTR5|RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf2 PE=1 SV=1 448 1211 0.0E+00
sp|Q9Y7U6|RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf1 PE=1 SV=1 293 1222 0.0E+00
sp|P51862|ROM2_YEAST RHO1 GDP-GTP exchange protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM2 PE=1 SV=1 456 1225 9.0E-164
sp|P53046|ROM1_YEAST RHO1 GDP-GTP exchange protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM1 PE=1 SV=2 336 1224 2.0E-141
sp|Q9Y7U5|RGF3_SCHPO Rho1 guanine nucleotide exchange factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf3 PE=1 SV=1 466 1182 9.0E-40
sp|Q9UTR5|RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf2 PE=1 SV=1 336 446 1.0E-30
sp|P51862|ROM2_YEAST RHO1 GDP-GTP exchange protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM2 PE=1 SV=1 309 444 9.0E-29
sp|Q91X46|ARHG3_MOUSE Rho guanine nucleotide exchange factor 3 OS=Mus musculus GN=Arhgef3 PE=1 SV=1 518 898 1.0E-22
sp|Q9N0A8|ARHG3_MACFA Rho guanine nucleotide exchange factor 3 OS=Macaca fascicularis GN=ARHGEF3 PE=2 SV=1 518 898 6.0E-22
sp|Q9NR81|ARHG3_HUMAN Rho guanine nucleotide exchange factor 3 OS=Homo sapiens GN=ARHGEF3 PE=1 SV=1 518 898 8.0E-22
sp|Q7Z628|ARHG8_HUMAN Neuroepithelial cell-transforming gene 1 protein OS=Homo sapiens GN=NET1 PE=1 SV=1 521 825 1.0E-21
sp|Q5R6F2|ARHG3_PONAB Rho guanine nucleotide exchange factor 3 OS=Pongo abelii GN=ARHGEF3 PE=2 SV=1 518 898 2.0E-21
sp|Q9Z206|ARHG8_MOUSE Neuroepithelial cell-transforming gene 1 protein OS=Mus musculus GN=Net1 PE=1 SV=2 521 825 2.0E-20
sp|Q5ZLX4|ARHG3_CHICK Rho guanine nucleotide exchange factor 3 OS=Gallus gallus GN=Arhgef3 PE=2 SV=1 518 894 3.0E-20
sp|Q9TW28|MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum GN=myoM PE=1 SV=1 531 794 2.0E-19
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 530 821 3.0E-18
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 530 821 2.0E-17
sp|Q553D3|GXCJJ_DICDI Rac guanine nucleotide exchange factor JJ OS=Dictyostelium discoideum GN=gxcJJ PE=1 SV=1 536 823 3.0E-17
sp|Q5VV41|ARHGG_HUMAN Rho guanine nucleotide exchange factor 16 OS=Homo sapiens GN=ARHGEF16 PE=1 SV=1 530 917 1.0E-16
sp|Q96DR7|ARHGQ_HUMAN Rho guanine nucleotide exchange factor 26 OS=Homo sapiens GN=ARHGEF26 PE=1 SV=4 502 809 2.0E-15
sp|Q9ES67|ARHGB_RAT Rho guanine nucleotide exchange factor 11 OS=Rattus norvegicus GN=Arhgef11 PE=1 SV=1 498 767 9.0E-15
sp|Q9NR80|ARHG4_HUMAN Rho guanine nucleotide exchange factor 4 OS=Homo sapiens GN=ARHGEF4 PE=1 SV=3 531 825 1.0E-14
sp|O15085|ARHGB_HUMAN Rho guanine nucleotide exchange factor 11 OS=Homo sapiens GN=ARHGEF11 PE=1 SV=1 498 767 2.0E-14
sp|Q69ZK0|PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus GN=Prex1 PE=1 SV=2 541 802 6.0E-14
sp|Q3U5C8|ARHGG_MOUSE Rho guanine nucleotide exchange factor 16 OS=Mus musculus GN=Arhgef16 PE=1 SV=3 530 917 6.0E-14
sp|Q8R4H2|ARHGC_MOUSE Rho guanine nucleotide exchange factor 12 OS=Mus musculus GN=Arhgef12 PE=1 SV=2 503 762 7.0E-13
sp|Q5DU57|SPT13_MOUSE Spermatogenesis-associated protein 13 OS=Mus musculus GN=Spata13 PE=1 SV=2 535 895 2.0E-12
sp|Q92888|ARHG1_HUMAN Rho guanine nucleotide exchange factor 1 OS=Homo sapiens GN=ARHGEF1 PE=1 SV=2 522 742 9.0E-12
sp|Q9NZN5|ARHGC_HUMAN Rho guanine nucleotide exchange factor 12 OS=Homo sapiens GN=ARHGEF12 PE=1 SV=1 503 762 1.0E-11
sp|Q9Z1I6|ARHG1_RAT Rho guanine nucleotide exchange factor 1 OS=Rattus norvegicus GN=Arhgef1 PE=2 SV=1 522 742 1.0E-11
sp|Q8TCU6|PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens GN=PREX1 PE=1 SV=3 537 748 2.0E-11
sp|Q61210|ARHG1_MOUSE Rho guanine nucleotide exchange factor 1 OS=Mus musculus GN=Arhgef1 PE=1 SV=2 522 742 3.0E-11
sp|Q70Z35|PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens GN=PREX2 PE=2 SV=1 529 825 4.0E-11
sp|Q96N96|SPT13_HUMAN Spermatogenesis-associated protein 13 OS=Homo sapiens GN=SPATA13 PE=1 SV=1 534 895 6.0E-11
sp|Q3LAC4|PREX2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Mus musculus GN=Prex2 PE=1 SV=2 529 825 8.0E-11
sp|Q5RDK0|ARHG9_PONAB Rho guanine nucleotide exchange factor 9 OS=Pongo abelii GN=ARHGEF9 PE=2 SV=1 537 825 1.0E-10
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 532 821 1.0E-10
sp|O88387|FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus GN=Fgd4 PE=1 SV=1 538 793 2.0E-10
sp|Q3KR16|PKHG6_HUMAN Pleckstrin homology domain-containing family G member 6 OS=Homo sapiens GN=PLEKHG6 PE=1 SV=3 519 818 2.0E-10
sp|Q58DL7|ARHG9_BOVIN Rho guanine nucleotide exchange factor 9 OS=Bos taurus GN=ARHGEF9 PE=2 SV=1 537 796 3.0E-10
sp|Q91ZT5|FGD4_MOUSE FYVE, RhoGEF and PH domain-containing protein 4 OS=Mus musculus GN=Fgd4 PE=1 SV=1 538 793 3.0E-10
sp|Q5JSP0|FGD3_HUMAN FYVE, RhoGEF and PH domain-containing protein 3 OS=Homo sapiens GN=FGD3 PE=1 SV=1 539 793 3.0E-10
sp|Q3UTH8|ARHG9_MOUSE Rho guanine nucleotide exchange factor 9 OS=Mus musculus GN=Arhgef9 PE=1 SV=1 537 796 3.0E-10
sp|Q5R5T1|FGD3_PONAB FYVE, RhoGEF and PH domain-containing protein 3 OS=Pongo abelii GN=FGD3 PE=2 SV=1 501 793 3.0E-10
sp|O43307|ARHG9_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens GN=ARHGEF9 PE=1 SV=3 537 796 4.0E-10
sp|Q7TNR9|ARHG4_MOUSE Rho guanine nucleotide exchange factor 4 OS=Mus musculus GN=Arhgef4 PE=2 SV=2 537 737 5.0E-10
sp|Q9QX73|ARHG9_RAT Rho guanine nucleotide exchange factor 9 OS=Rattus norvegicus GN=Arhgef9 PE=1 SV=1 537 737 5.0E-10
sp|O94827|PKHG5_HUMAN Pleckstrin homology domain-containing family G member 5 OS=Homo sapiens GN=PLEKHG5 PE=1 SV=3 528 895 8.0E-10
sp|Q96M96|FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens GN=FGD4 PE=1 SV=2 538 793 9.0E-10
sp|Q12802|AKP13_HUMAN A-kinase anchor protein 13 OS=Homo sapiens GN=AKAP13 PE=1 SV=2 540 899 1.0E-09
sp|Q66T02|PKHG5_MOUSE Pleckstrin homology domain-containing family G member 5 OS=Mus musculus GN=Plekhg5 PE=1 SV=1 528 895 1.0E-09
sp|Q1ZXH8|GXCDD_DICDI Guanine exchange factor for Rac 30 OS=Dictyostelium discoideum GN=gxcDD PE=3 SV=3 540 737 1.0E-09
sp|Q8R0J1|PKHG6_MOUSE Pleckstrin homology domain-containing family G member 6 OS=Mus musculus GN=Plekhg6 PE=2 SV=2 541 823 2.0E-09
sp|Q7Z6J4|FGD2_HUMAN FYVE, RhoGEF and PH domain-containing protein 2 OS=Homo sapiens GN=FGD2 PE=1 SV=1 542 828 2.0E-09
sp|Q6RFZ7|PKHG5_RAT Pleckstrin homology domain-containing family G member 5 OS=Rattus norvegicus GN=Plekhg5 PE=1 SV=1 528 823 3.0E-09
sp|Q07139|ECT2_MOUSE Protein ECT2 OS=Mus musculus GN=Ect2 PE=1 SV=2 537 812 3.0E-09
sp|Q9H8V3|ECT2_HUMAN Protein ECT2 OS=Homo sapiens GN=ECT2 PE=1 SV=4 534 812 3.0E-09
sp|Q6ZSZ5|ARHGI_HUMAN Rho guanine nucleotide exchange factor 18 OS=Homo sapiens GN=ARHGEF18 PE=1 SV=3 518 761 4.0E-09
sp|Q54B37|GXCJ_DICDI RhoGEF domain-containing protein gxcJ OS=Dictyostelium discoideum GN=gxcJ PE=3 SV=1 541 773 9.0E-09
sp|Q80VK6|ARH38_MOUSE Rho guanine nucleotide exchange factor 38 OS=Mus musculus GN=Arhgef38 PE=1 SV=2 540 754 2.0E-08
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 532 797 2.0E-08
sp|Q8BY35|FGD2_MOUSE FYVE, RhoGEF and PH domain-containing protein 2 OS=Mus musculus GN=Fgd2 PE=1 SV=1 522 825 3.0E-08
sp|Q5FWH6|ARHGF_MOUSE Rho guanine nucleotide exchange factor 15 OS=Mus musculus GN=Arhgef15 PE=1 SV=1 530 775 4.0E-08
sp|Q9ULL1|PKHG1_HUMAN Pleckstrin homology domain-containing family G member 1 OS=Homo sapiens GN=PLEKHG1 PE=1 SV=2 509 830 4.0E-08
sp|Q8IW93|ARHGJ_HUMAN Rho guanine nucleotide exchange factor 19 OS=Homo sapiens GN=ARHGEF19 PE=1 SV=1 589 802 4.0E-08
sp|O75962|TRIO_HUMAN Triple functional domain protein OS=Homo sapiens GN=TRIO PE=1 SV=2 532 734 5.0E-08
sp|O15013|ARHGA_HUMAN Rho guanine nucleotide exchange factor 10 OS=Homo sapiens GN=ARHGEF10 PE=1 SV=4 415 771 5.0E-08
sp|Q1LUA6|TRIO_DANRE Triple functional domain protein OS=Danio rerio GN=trio PE=3 SV=1 532 794 7.0E-08
sp|Q8BWA8|ARHGJ_MOUSE Rho guanine nucleotide exchange factor 19 OS=Mus musculus GN=Arhgef19 PE=1 SV=1 537 802 7.0E-08
sp|O88842|FGD3_MOUSE FYVE, RhoGEF and PH domain-containing protein 3 OS=Mus musculus GN=Fgd3 PE=1 SV=1 539 748 1.0E-07
sp|Q11100|TAG52_CAEEL Putative protein tag-52 OS=Caenorhabditis elegans GN=tag-52 PE=3 SV=1 526 799 1.0E-07
sp|Q0KL02|TRIO_MOUSE Triple functional domain protein OS=Mus musculus GN=Trio PE=1 SV=3 532 729 2.0E-07
sp|P11433|CDC24_YEAST Cell division control protein 24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC24 PE=1 SV=2 543 794 2.0E-07
sp|P27870|VAV_MOUSE Proto-oncogene vav OS=Mus musculus GN=Vav1 PE=1 SV=1 504 890 2.0E-07
sp|Q6ZPF3|TIAM2_MOUSE T-lymphoma invasion and metastasis-inducing protein 2 OS=Mus musculus GN=Tiam2 PE=1 SV=2 527 812 2.0E-07
sp|P54100|VAV_RAT Proto-oncogene vav OS=Rattus norvegicus GN=Vav1 PE=2 SV=1 540 890 2.0E-07
sp|Q8C033|ARHGA_MOUSE Rho guanine nucleotide exchange factor 10 OS=Mus musculus GN=Arhgef10 PE=1 SV=2 517 771 3.0E-07
sp|Q6P9R4|ARHGI_MOUSE Rho guanine nucleotide exchange factor 18 OS=Mus musculus GN=Arhgef18 PE=1 SV=2 500 744 3.0E-07
sp|Q8N1W1|ARG28_HUMAN Rho guanine nucleotide exchange factor 28 OS=Homo sapiens GN=ARHGEF28 PE=1 SV=3 540 736 3.0E-07
sp|Q7TT49|MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus GN=Cdc42bpb PE=1 SV=1 870 1201 4.0E-07
sp|Q8IVF5|TIAM2_HUMAN T-lymphoma invasion and metastasis-inducing protein 2 OS=Homo sapiens GN=TIAM2 PE=2 SV=4 527 812 4.0E-07
sp|Q008S8|ECT2L_HUMAN Epithelial cell-transforming sequence 2 oncogene-like OS=Homo sapiens GN=ECT2L PE=2 SV=2 539 729 1.0E-06
sp|P97924|KALRN_RAT Kalirin OS=Rattus norvegicus GN=Kalrn PE=1 SV=3 541 822 1.0E-06
sp|Q91VS8|FARP2_MOUSE FERM, RhoGEF and pleckstrin domain-containing protein 2 OS=Mus musculus GN=Farp2 PE=1 SV=2 544 775 2.0E-06
sp|Q9R0C8|VAV3_MOUSE Guanine nucleotide exchange factor VAV3 OS=Mus musculus GN=Vav3 PE=1 SV=2 486 895 3.0E-06
sp|A2CG49|KALRN_MOUSE Kalirin OS=Mus musculus GN=Kalrn PE=1 SV=1 491 721 4.0E-06
sp|P15498|VAV_HUMAN Proto-oncogene vav OS=Homo sapiens GN=VAV1 PE=1 SV=4 540 890 5.0E-06
sp|O60229|KALRN_HUMAN Kalirin OS=Homo sapiens GN=KALRN PE=1 SV=2 491 721 6.0E-06
sp|Q9NXL2|ARH38_HUMAN Rho guanine nucleotide exchange factor 38 OS=Homo sapiens GN=ARHGEF38 PE=2 SV=2 540 729 7.0E-06
sp|P97924|KALRN_RAT Kalirin OS=Rattus norvegicus GN=Kalrn PE=1 SV=3 491 721 8.0E-06
sp|B2DCZ9|ARHG2_PIG Rho guanine nucleotide exchange factor 2 OS=Sus scrofa GN=ARHGEF2 PE=2 SV=1 540 748 9.0E-06
sp|Q12774|ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens GN=ARHGEF5 PE=1 SV=3 533 802 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0035556 intracellular signal transduction Yes
GO:0005085 guanyl-nucleotide exchange factor activity Yes
GO:0050789 regulation of biological process No
GO:0098772 molecular function regulator activity No
GO:0030234 enzyme regulator activity No
GO:0065007 biological regulation No
GO:0007165 signal transduction No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0030695 GTPase regulator activity No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0050794 regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2381
MADYHYDPRAAPQRPRAYPDSNNHHQRDAAFSNIFGAAPPPGRSQTMTASSSHPAMMEPGRTQTMSMGSGPPRQP
PGRVQQPYLYGAEHARSSPYASHHAGQRSASGSQSSTSSQPQQSPQQQYQQQQQQQQPPRRPYTGAGGPPPPRFE
ARPSPQAAAMRYQPQRSYQNAPAPALNSDPYRSQSLASMPRPQIYHPPPSSYQQQHSPANHSRYAQYGQQNSART
TAQGRVVPERHEDRTMSMTGGGFHPQDRDAHQTMSGRVIPNRRAPSDTANGYPLQGAAYSNMPGAQTRATGMSSP
TGTSSDHSRTMSMASSIAPTIVASDSDPSTPTQRPSRSKSIESERPPTATKIRPPLVYPALLSRVAECFRRKIIL
GDRTKNELTYKNAFSGSEAVDVLSYIIRTTDRNLALLLGRALDAQKFFHDVTYEHRLRDSMAEMYQLRETLMDEP
EDKSPVNGIFVLLSECYSPTCTRDQLCYSIACPRRLEQVSRLNLKTGPGLRKEDSANVNDDEADQTDEQKLWINS
VPKEIADAVDEREKKRQEVISEICYTERDFVKDLEYLRDFWINPLRSKASPIPLQRREKAVKNIFSNIVDHPSIH
SVSSRFASSLTGRQGKEPIVYNIGDIFLEFVPQFEPFITYGSRQLEGKFEFENERSINPLFGKFVDEIERRKESR
KLELNGYLTKPTTRLARYPLLLENVLKYTEGDNPDKTDIPKVLTMIRDLLGRVNAESGKAENRFNLRRLHDQLRF
RPNERVDLKLTEEGRELVFKSQLKKSPTDPTEITAFLFDHAVLLVRIKQSGKNEEIKAYRRPIPLELLSIREMDE
VIPAQGVKRSSSSLIPSIRTNNSEAKKGEGWPITFRHLGKAGYELALFAANQAARKKWLEFIDNAQQRLRSRADF
FNTTIVSSSFFVGANQIRCVTPFDGGRKLLYGTDNGIYLSDRKNREQVPRRVLETTNVTQIDILEEYQLLLVLSN
KTLHSYSISVLNPDEAALAKRPKKIQNHCSFFKTGICMGRHLVCCVKSSALSTTIKVFEPNDAMTKAKKQKGLGK
FMAGQDELRPFKEFYIPTESSSVHFLKSKLCVACARGFEVVSLETLETQALLDQADTSLDFVARKEGVKPIHIER
LNGEFLLNYSEFSFFVNRNGWRARPEWRIDWEGTPQSFALSYPWILAFEANFIELRNIENGAVHIVPHKNIRMLH
SSTHEILFAYEDERGEDVVEAIDFWKNTRRTEPAAGQTSSGR*
Coding >Ophun1|2381
ATGGCCGATTATCACTATGACCCTCGAGCAGCTCCCCAGCGCCCTCGCGCCTATCCCGACTCGAATAATCATCAC
CAGCGCGACGCCGCCTTCTCCAACATCTTCGGCGCCGCCCCTCCCCCGGGCCGATCCCAGACCATGACCGCTTCC
TCCTCGCATCCCGCCATGATGGAGCCGGGTAGAACCCAGACCATGTCCATGGGCTCCGGCCCGCCTCGGCAACCC
CCGGGGCGCGTCCAACAACCATATCTCTACGGCGCCGAACACGCTAGATCCAGTCCCTACGCCAGTCACCATGCC
GGCCAGCGTTCGGCTTCGGGCAGCCAGTCGTCCACCTCTTCCCAGCCGCAGCAATCACCGCAACAGCAATACCAA
CAGCAGCAGCAACAGCAACAGCCGCCTAGGAGACCATACACGGGTGCCGGAGGCCCTCCCCCGCCGCGATTCGAG
GCTCGGCCCTCGCCACAGGCCGCCGCCATGCGCTATCAACCACAAAGATCCTACCAGAACGCTCCCGCCCCGGCC
CTCAACAGCGACCCCTACCGTTCCCAGTCGTTGGCTTCCATGCCACGTCCGCAAATATACCACCCGCCCCCGAGC
TCCTACCAGCAGCAGCACTCGCCCGCGAACCACTCCCGCTACGCCCAGTATGGCCAGCAGAACTCGGCCCGGACG
ACGGCGCAGGGCCGCGTCGTGCCCGAACGCCACGAGGACCGCACCATGTCCATGACCGGAGGGGGCTTTCACCCG
CAGGACAGGGACGCTCACCAGACCATGAGCGGACGCGTCATCCCGAACCGACGGGCTCCATCAGACACTGCTAAC
GGCTACCCGCTGCAGGGCGCCGCCTACTCCAACATGCCCGGTGCGCAGACGCGCGCCACCGGCATGAGCTCGCCC
ACCGGCACCTCGTCGGACCACTCGAGGACCATGTCGATGGCGTCTAGCATCGCGCCGACGATTGTGGCCTCGGAC
TCGGATCCCTCTACGCCCACGCAGCGACCGTCTAGGAGCAAGTCGATCGAGAGCGAACGGCCCCCGACGGCCACC
AAGATACGGCCGCCGCTGGTCTATCCGGCCCTGCTGTCGCGCGTCGCCGAGTGCTTCCGGCGGAAAATCATCCTC
GGCGACCGGACCAAGAACGAGTTGACGTACAAAAATGCCTTCAGCGGCTCCGAGGCCGTCGATGTGTTGTCGTAC
ATAATCAGGACGACGGATCGGAACCTGGCCCTCCTCTTGGGCCGCGCTCTCGACGCGCAAAAGTTCTTTCACGAC
GTCACGTACGAGCACCGGCTGCGAGATTCCATGGCGGAGATGTACCAGCTCCGCGAGACGCTCATGGACGAGCCC
GAAGACAAGTCCCCCGTCAACGGCATCTTCGTCTTGCTCTCCGAGTGCTACTCGCCCACATGCACGCGGGACCAG
CTCTGCTACTCCATCGCCTGTCCGCGGCGTCTGGAGCAGGTCTCGAGGCTGAACCTCAAGACGGGCCCGGGTCTG
CGCAAGGAGGATTCGGCCAACGTCAACGACGATGAGGCCGATCAGACGGACGAGCAGAAGCTCTGGATCAACTCG
GTGCCCAAGGAGATTGCAGACGCCGTGGATGAGCGGGAAAAGAAGAGGCAAGAGGTCATCTCGGAGATTTGCTAC
ACGGAGCGCGACTTCGTCAAGGATCTCGAGTACCTGCGCGACTTTTGGATTAATCCCCTGCGGTCCAAGGCGTCT
CCGATTCCGCTGCAACGAAGGGAGAAGGCGGTCAAGAACATCTTTAGTAACATCGTCGACCACCCAAGCATCCAC
TCGGTGAGCTCACGCTTCGCCTCGTCCCTCACGGGGCGGCAAGGCAAGGAGCCCATCGTGTACAACATTGGCGAC
ATCTTCCTCGAGTTCGTGCCGCAGTTTGAGCCTTTTATAACGTACGGGTCCCGGCAGCTCGAGGGCAAGTTCGAG
TTTGAGAACGAACGGTCCATCAACCCGCTCTTTGGCAAGTTTGTCGACGAGATTGAGCGGCGGAAGGAATCGCGC
AAGCTGGAGCTCAACGGCTACCTGACGAAGCCGACGACGCGGTTGGCGCGATACCCGCTGCTGCTGGAGAACGTG
CTCAAGTACACCGAGGGCGACAACCCGGACAAGACGGATATCCCCAAGGTGCTCACCATGATCCGCGACTTGCTG
GGGAGAGTCAACGCCGAGTCGGGCAAGGCGGAGAATCGGTTCAACCTGCGGCGGCTGCACGACCAGCTACGCTTC
CGTCCCAACGAGCGCGTCGACCTGAAGCTGACGGAGGAGGGCCGCGAGCTGGTGTTCAAGAGCCAGCTCAAGAAG
TCGCCGACGGACCCGACGGAGATTACCGCCTTTCTCTTCGACCACGCCGTTCTGCTGGTGCGTATCAAGCAGAGC
GGGAAGAACGAGGAGATCAAAGCGTACCGGAGGCCGATTCCGCTCGAGCTGCTGTCGATCCGCGAGATGGACGAG
GTGATTCCGGCGCAGGGTGTTAAGCGGTCGTCGTCGAGCTTGATACCGTCGATACGGACCAACAACTCGGAGGCC
AAGAAGGGCGAGGGCTGGCCCATTACGTTCCGACACTTGGGCAAGGCTGGGTACGAGCTGGCGCTGTTTGCGGCC
AACCAGGCGGCTCGCAAGAAGTGGCTCGAGTTTATCGACAATGCCCAGCAGCGGCTACGATCGCGGGCCGACTTT
TTCAACACGACGATTGTGTCGAGCAGCTTCTTTGTGGGCGCCAACCAGATTCGCTGTGTGACGCCGTTTGACGGC
GGCCGGAAGCTGCTGTACGGAACGGATAACGGCATCTACCTCTCGGATCGCAAGAACCGCGAACAGGTGCCTCGG
CGGGTGCTGGAGACGACCAACGTGACGCAGATCGACATATTGGAGGAGTACCAGCTACTGCTCGTGCTGTCCAAC
AAGACGCTACACTCGTACTCGATCTCGGTGCTGAACCCGGACGAGGCGGCGCTGGCGAAGCGGCCCAAGAAGATA
CAGAATCACTGCAGCTTCTTCAAGACGGGTATCTGCATGGGGCGTCACCTGGTGTGCTGCGTCAAGTCTTCAGCG
CTCTCGACGACGATCAAGGTGTTTGAGCCCAACGACGCCATGACCAAGGCCAAGAAGCAAAAGGGGCTGGGCAAG
TTTATGGCGGGTCAGGACGAGCTGCGGCCGTTTAAGGAGTTTTACATTCCTACGGAGTCGTCGTCGGTGCACTTT
CTCAAGTCGAAGCTGTGCGTCGCCTGCGCCCGAGGCTTCGAGGTGGTTTCGCTCGAGACGCTCGAGACGCAGGCT
CTTCTGGACCAGGCAGACACGTCGCTCGACTTTGTGGCGCGCAAAGAGGGCGTCAAGCCGATTCACATTGAGCGT
CTCAACGGCGAGTTTCTGCTCAACTACTCCGAGTTTTCCTTCTTCGTCAACCGCAACGGCTGGCGGGCGCGGCCT
GAATGGCGTATCGACTGGGAGGGCACGCCCCAGAGCTTCGCCCTGAGTTACCCGTGGATCCTGGCCTTTGAGGCC
AACTTTATCGAGCTGCGGAATATCGAGAACGGGGCGGTGCACATTGTGCCGCACAAGAACATACGGATGCTTCAC
AGCAGCACGCACGAGATCTTGTTTGCGTACGAGGACGAGCGAGGAGAAGACGTGGTCGAGGCCATTGACTTTTGG
AAGAATACCAGACGGACCGAGCCGGCGGCGGGACAGACGTCGTCGGGACGGTAG
Transcript >Ophun1|2381
ATGGCCGATTATCACTATGACCCTCGAGCAGCTCCCCAGCGCCCTCGCGCCTATCCCGACTCGAATAATCATCAC
CAGCGCGACGCCGCCTTCTCCAACATCTTCGGCGCCGCCCCTCCCCCGGGCCGATCCCAGACCATGACCGCTTCC
TCCTCGCATCCCGCCATGATGGAGCCGGGTAGAACCCAGACCATGTCCATGGGCTCCGGCCCGCCTCGGCAACCC
CCGGGGCGCGTCCAACAACCATATCTCTACGGCGCCGAACACGCTAGATCCAGTCCCTACGCCAGTCACCATGCC
GGCCAGCGTTCGGCTTCGGGCAGCCAGTCGTCCACCTCTTCCCAGCCGCAGCAATCACCGCAACAGCAATACCAA
CAGCAGCAGCAACAGCAACAGCCGCCTAGGAGACCATACACGGGTGCCGGAGGCCCTCCCCCGCCGCGATTCGAG
GCTCGGCCCTCGCCACAGGCCGCCGCCATGCGCTATCAACCACAAAGATCCTACCAGAACGCTCCCGCCCCGGCC
CTCAACAGCGACCCCTACCGTTCCCAGTCGTTGGCTTCCATGCCACGTCCGCAAATATACCACCCGCCCCCGAGC
TCCTACCAGCAGCAGCACTCGCCCGCGAACCACTCCCGCTACGCCCAGTATGGCCAGCAGAACTCGGCCCGGACG
ACGGCGCAGGGCCGCGTCGTGCCCGAACGCCACGAGGACCGCACCATGTCCATGACCGGAGGGGGCTTTCACCCG
CAGGACAGGGACGCTCACCAGACCATGAGCGGACGCGTCATCCCGAACCGACGGGCTCCATCAGACACTGCTAAC
GGCTACCCGCTGCAGGGCGCCGCCTACTCCAACATGCCCGGTGCGCAGACGCGCGCCACCGGCATGAGCTCGCCC
ACCGGCACCTCGTCGGACCACTCGAGGACCATGTCGATGGCGTCTAGCATCGCGCCGACGATTGTGGCCTCGGAC
TCGGATCCCTCTACGCCCACGCAGCGACCGTCTAGGAGCAAGTCGATCGAGAGCGAACGGCCCCCGACGGCCACC
AAGATACGGCCGCCGCTGGTCTATCCGGCCCTGCTGTCGCGCGTCGCCGAGTGCTTCCGGCGGAAAATCATCCTC
GGCGACCGGACCAAGAACGAGTTGACGTACAAAAATGCCTTCAGCGGCTCCGAGGCCGTCGATGTGTTGTCGTAC
ATAATCAGGACGACGGATCGGAACCTGGCCCTCCTCTTGGGCCGCGCTCTCGACGCGCAAAAGTTCTTTCACGAC
GTCACGTACGAGCACCGGCTGCGAGATTCCATGGCGGAGATGTACCAGCTCCGCGAGACGCTCATGGACGAGCCC
GAAGACAAGTCCCCCGTCAACGGCATCTTCGTCTTGCTCTCCGAGTGCTACTCGCCCACATGCACGCGGGACCAG
CTCTGCTACTCCATCGCCTGTCCGCGGCGTCTGGAGCAGGTCTCGAGGCTGAACCTCAAGACGGGCCCGGGTCTG
CGCAAGGAGGATTCGGCCAACGTCAACGACGATGAGGCCGATCAGACGGACGAGCAGAAGCTCTGGATCAACTCG
GTGCCCAAGGAGATTGCAGACGCCGTGGATGAGCGGGAAAAGAAGAGGCAAGAGGTCATCTCGGAGATTTGCTAC
ACGGAGCGCGACTTCGTCAAGGATCTCGAGTACCTGCGCGACTTTTGGATTAATCCCCTGCGGTCCAAGGCGTCT
CCGATTCCGCTGCAACGAAGGGAGAAGGCGGTCAAGAACATCTTTAGTAACATCGTCGACCACCCAAGCATCCAC
TCGGTGAGCTCACGCTTCGCCTCGTCCCTCACGGGGCGGCAAGGCAAGGAGCCCATCGTGTACAACATTGGCGAC
ATCTTCCTCGAGTTCGTGCCGCAGTTTGAGCCTTTTATAACGTACGGGTCCCGGCAGCTCGAGGGCAAGTTCGAG
TTTGAGAACGAACGGTCCATCAACCCGCTCTTTGGCAAGTTTGTCGACGAGATTGAGCGGCGGAAGGAATCGCGC
AAGCTGGAGCTCAACGGCTACCTGACGAAGCCGACGACGCGGTTGGCGCGATACCCGCTGCTGCTGGAGAACGTG
CTCAAGTACACCGAGGGCGACAACCCGGACAAGACGGATATCCCCAAGGTGCTCACCATGATCCGCGACTTGCTG
GGGAGAGTCAACGCCGAGTCGGGCAAGGCGGAGAATCGGTTCAACCTGCGGCGGCTGCACGACCAGCTACGCTTC
CGTCCCAACGAGCGCGTCGACCTGAAGCTGACGGAGGAGGGCCGCGAGCTGGTGTTCAAGAGCCAGCTCAAGAAG
TCGCCGACGGACCCGACGGAGATTACCGCCTTTCTCTTCGACCACGCCGTTCTGCTGGTGCGTATCAAGCAGAGC
GGGAAGAACGAGGAGATCAAAGCGTACCGGAGGCCGATTCCGCTCGAGCTGCTGTCGATCCGCGAGATGGACGAG
GTGATTCCGGCGCAGGGTGTTAAGCGGTCGTCGTCGAGCTTGATACCGTCGATACGGACCAACAACTCGGAGGCC
AAGAAGGGCGAGGGCTGGCCCATTACGTTCCGACACTTGGGCAAGGCTGGGTACGAGCTGGCGCTGTTTGCGGCC
AACCAGGCGGCTCGCAAGAAGTGGCTCGAGTTTATCGACAATGCCCAGCAGCGGCTACGATCGCGGGCCGACTTT
TTCAACACGACGATTGTGTCGAGCAGCTTCTTTGTGGGCGCCAACCAGATTCGCTGTGTGACGCCGTTTGACGGC
GGCCGGAAGCTGCTGTACGGAACGGATAACGGCATCTACCTCTCGGATCGCAAGAACCGCGAACAGGTGCCTCGG
CGGGTGCTGGAGACGACCAACGTGACGCAGATCGACATATTGGAGGAGTACCAGCTACTGCTCGTGCTGTCCAAC
AAGACGCTACACTCGTACTCGATCTCGGTGCTGAACCCGGACGAGGCGGCGCTGGCGAAGCGGCCCAAGAAGATA
CAGAATCACTGCAGCTTCTTCAAGACGGGTATCTGCATGGGGCGTCACCTGGTGTGCTGCGTCAAGTCTTCAGCG
CTCTCGACGACGATCAAGGTGTTTGAGCCCAACGACGCCATGACCAAGGCCAAGAAGCAAAAGGGGCTGGGCAAG
TTTATGGCGGGTCAGGACGAGCTGCGGCCGTTTAAGGAGTTTTACATTCCTACGGAGTCGTCGTCGGTGCACTTT
CTCAAGTCGAAGCTGTGCGTCGCCTGCGCCCGAGGCTTCGAGGTGGTTTCGCTCGAGACGCTCGAGACGCAGGCT
CTTCTGGACCAGGCAGACACGTCGCTCGACTTTGTGGCGCGCAAAGAGGGCGTCAAGCCGATTCACATTGAGCGT
CTCAACGGCGAGTTTCTGCTCAACTACTCCGAGTTTTCCTTCTTCGTCAACCGCAACGGCTGGCGGGCGCGGCCT
GAATGGCGTATCGACTGGGAGGGCACGCCCCAGAGCTTCGCCCTGAGTTACCCGTGGATCCTGGCCTTTGAGGCC
AACTTTATCGAGCTGCGGAATATCGAGAACGGGGCGGTGCACATTGTGCCGCACAAGAACATACGGATGCTTCAC
AGCAGCACGCACGAGATCTTGTTTGCGTACGAGGACGAGCGAGGAGAAGACGTGGTCGAGGCCATTGACTTTTGG
AAGAATACCAGACGGACCGAGCCGGCGGCGGGACAGACGTCGTCGGGACGGTAG
Gene >Ophun1|2381
ATGGCCGATTATCACTATGACCCTCGAGCAGCTCCCCAGCGCCCTCGCGCCTATCCCGACTCGAATAATCATCAC
CAGCGCGACGCCGCCTTCTCCAACATCTTCGGCGCCGCCCCTCCCCCGGGCCGATCCCAGACCATGACCGCTTCC
TCCTCGCATCCCGCCATGATGGAGCCGGGTAGAACCCAGACCATGTCCATGGGCTCCGGCCCGCCTCGGCAACCC
CCGGGGCGCGTCCAACAACCATATCTCTACGGCGCCGAACACGCTAGATCCAGTCCCTACGCCAGTCACCATGCC
GGCCAGCGTTCGGCTTCGGGCAGCCAGTCGTCCACCTCTTCCCAGCCGCAGCAATCACCGCAACAGCAATACCAA
CAGCAGCAGCAACAGCAACAGCCGCCTAGGAGACCATACACGGGTGCCGGAGGCCCTCCCCCGCCGCGATTCGAG
GCTCGGCCCTCGCCACAGGCCGCCGCCATGCGCTATCAACCACAAAGATCCTACCAGAACGCTCCCGCCCCGGCC
CTCAACAGCGACCCCTACCGTTCCCAGTCGTTGGCTTCCATGCCACGTCCGCAAATATACCACCCGCCCCCGAGC
TCCTACCAGCAGCAGCACTCGCCCGCGAACCACTCCCGCTACGCCCAGTATGGCCAGCAGAACTCGGCCCGGACG
ACGGCGCAGGGCCGCGTCGTGCCCGAACGCCACGAGGACCGCACCATGTCCATGACCGGAGGGGGCTTTCACCCG
CAGGACAGGGACGCTCACCAGACCATGAGCGGACGCGTCATCCCGAACCGACGGGCTCCATCAGACACTGCTAAC
GGCTACCCGCTGCAGGGCGCCGCCTACTCCAACATGCCCGGTGCGCAGACGCGCGCCACCGGCATGAGCTCGCCC
ACCGGCACCTCGTCGGACCACTCGAGGACCATGTCGATGGCGTCTAGCATCGCGCCGACGATTGTGGCCTCGGAC
TCGGATCCCTCTACGCCCACGCAGCGACCGTCTAGGAGCAAGTCGATCGAGAGCGAACGGCCCCCGACGGCCACC
AAGATACGGCCGCCGCTGGTCTATCCGGCCCTGCTGTCGCGCGTCGCCGAGTGCTTCCGGCGGAAAATCATCCTC
GGCGACCGGACCAAGAACGAGTTGACGTACAAAAATGCCTTCAGCGGCTCCGAGGCCGTCGATGTGTTGTCGTAC
ATAATCAGGACGACGGATCGGAACCTGGCCCTCCTCTTGGGCCGCGCTCTCGACGCGCAAAAGTTCTTTCACGAC
GTCACGTACGAGCACCGGCTGCGAGATTCCATGGCGGAGATGTACCAGCTCCGCGAGACGCTCATGGACGAGCCC
GAAGACAAGTCCCCCGTCAACGGCATCTTCGTCTTGCTCTCCGAGTGCTACTCGCCCACATGCACGCGGGACCAG
CTCTGCTACTCCATCGCCTGTCCGCGGCGTCTGGAGCAGGTCTCGAGGCTGAACCTCAAGACGGGCCCGGGTCTG
CGCAAGGAGGATTCGGCCAACGTCAACGACGATGAGGCCGATCAGACGGACGAGCAGAAGCTCTGGATCAACTCG
GTGCCCAAGGAGATTGCAGACGCCGTGGATGAGCGGGAAAAGAAGAGGCAAGAGGTCATCTCGGAGATTTGCTAC
ACGGAGCGCGACTTCGTCAAGGATCTCGAGTACCTGCGCGACTTTTGGATTAATCCCCTGCGGTCCAAGGCGTCT
CCGATTCCGCTGCAACGAAGGGAGAAGGCGGTCAAGAACATCTTTAGTAACATCGTCGACCACCCAAGCATCCAC
TCGGTGAGCTCACGCTTCGCCTCGTCCCTCACGGGGCGGCAAGGCAAGGAGCCCATCGTGTACAACATTGGCGAC
ATCTTCCTCGAGTTCGTGCCGCAGTTTGAGCCTTTTATAACGTACGGGTCCCGGCAGCTCGAGGGCAAGTTCGAG
TTTGAGAACGAACGGTCCATCAACCCGCTCTTTGGCAAGTTTGTCGACGAGATTGAGCGGCGGAAGGAATCGCGC
AAGCTGGAGCTCAACGGCTACCTGACGAAGCCGACGACGCGGTTGGCGCGATACCCGCTGCTGCTGGAGAACGTG
CTCAAGTACACCGAGGGCGACAACCCGGACAAGACGGATATCCCCAAGGTGCTCACCATGATCCGCGACTTGCTG
GGGAGAGTCAACGCCGAGTCGGGCAAGGCGGAGAATCGGTTCAACCTGCGGCGGCTGCACGACCAGCTACGCTTC
CGTCCCAACGAGCGCGTCGACCTGAAGCTGACGGAGGAGGGCCGCGAGCTGGTGTTCAAGAGCCAGCTCAAGAAG
TCGCCGACGGACCCGACGGAGATTACCGCCTTTCTCTTCGACCACGCCGTTCTGCTGGTGCGTATCAAGCAGAGC
GGGAAGAACGAGGAGATCAAAGCGTACCGGAGGCCGATTCCGCTCGAGCTGCTGTCGATCCGCGAGATGGACGAG
GTGATTCCGGCGCAGGGTGTTAAGCGGTCGTCGTCGAGCTTGATACCGTCGATACGGACCAACAACTCGGAGGCC
AAGAAGGGCGAGGGCTGGCCCATTACGTTCCGACACTTGGGCAAGGCTGGGTACGAGCTGGCGCTGTTTGCGGCC
AACCAGGCGGCTCGCAAGAAGTGGCTCGAGTTTATCGACAATGCCCAGCAGCGGCTACGATCGCGGGCCGACTTT
TTCAACACGACGATTGTGTCGAGCAGCTTCTTTGTGGGCGCCAACCAGATTCGCTGTGTGACGCCGTTTGGTGAG
TCTTGTTGGATGGTTATGCTGTATTCTGCTGACGACTAGCTACAGACGGCGGCCGGAAGCTGCTGTACGGAACGG
ATAACGGCATCTACCTCTCGGATCGCAAGAACCGCGAACAGGTGCCTCGGCGGGTGCTGGAGACGACCAACGTGA
CGCAGATCGACATATTGGAGGAGTACCAGCTACTGCTCGTGCTGTCCAACAAGACGCTACACTCGTACTCGATCT
CGGTGCTGAACCCGGACGAGGCGGCGCTGGCGAAGCGGCCCAAGAAGATACAGAATCACTGCAGCTTCTTCAAGA
CGGGTATCTGCATGGGGCGTCACCTGGTGTGCTGCGTCAAGTCTTCAGCGCTCTCGACGACGATCAAGGTGTTTG
AGCCCAACGACGCCATGACCAAGGCCAAGAAGCAAAAGGGGCTGGGCAAGTTTATGGCGGGTCAGGACGAGCTGC
GGCCGTTTAAGGAGTTTTACATTCCTACGGAGTCGTCGTCGGTGCACTTTCTCAAGTCGAAGCTGTGCGTCGCCT
GCGCCCGAGGCTTCGAGGTGGTTTCGCTCGAGACGCTCGAGACGCAGGCTCTTCTGGACCAGGCAGACACGTCGC
TCGACTTTGTGGCGCGCAAAGAGGGCGTCAAGCCGATTCACATTGAGCGTCTCAACGGCGAGTTTCTGCTCAACT
ACTCCGAGTTTTCCTTCTTCGTCAACCGCAACGGCTGGCGGGCGCGGCCTGAATGGCGTATCGACTGGGAGGGCA
CGCCCCAGAGCTTCGCCCTGAGTTACCCGTGGATCCTGGCCTTTGAGGCCAACTTTATCGAGCTGCGGAATATCG
AGAACGGGGCGGTGCACATTGTGCCGCACAAGAACATACGGATGCTTCACAGCAGCACGCACGAGGTGGGCTTTC
ATGATTTGTGTTGTGGCTATTCGATACTGACGTGGAGCAGATCTTGTTTGCGTACGAGGACGAGCGAGGAGAAGA
CGTGGTCGAGGCCATTGACTTTTGGAAGAATACCAGACGGACCGAGCCGGCGGCGGGACAGACGTCGTCGGGACG
GTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail