Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2376
Gene name
LocationContig_2160:32..967
Strand+
Gene length (bp)935
Transcript length (bp)807
Coding sequence length (bp)807
Protein length (aa) 269

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup474
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5945
Ophiocordyceps australis map64 (Brazil) OphauB2|7945
Ophiocordyceps camponoti-floridani Ophcf2|06480
Ophiocordyceps camponoti-rufipedis Ophun1|1610
Ophiocordyceps camponoti-rufipedis Ophun1|2376 (this protein)
Ophiocordyceps kimflemingae Ophio5|8585
Ophiocordyceps subramaniannii Hirsu2|10454

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2376
MAPGYSPRRSAPQTRSQSPSAEARAHYALSHNGIMAANSRSGAGSPSHEMSGSGRPYPKRTREIQQEGKSTAPLN
MWSGPPTSGNSTPLRENIPESPTDGFPDFAQLPTPESLPPTRRARAGTVPSRFSPGGPLSVQSLAPKSARATPSA
PTPFNKSQSPSPSLDPPEGSSSSGSALLSRLRAGSMPQRSPFAPAPATAAPAGSPFGPSIFSTGWNPAGVGRERG
STLASIASVGSNGPSSPAQSQFSSKEAVGESDGPARHALHGQL*
Coding >Ophun1|2376
ATGGCGCCTGGCTATTCTCCGCGCCGCTCCGCCCCCCAAACTCGCTCGCAATCACCCTCTGCCGAAGCCAGAGCT
CATTACGCCCTCAGTCACAACGGCATCATGGCCGCCAACTCGCGATCCGGGGCTGGTTCTCCGTCGCACGAAATG
TCCGGCTCGGGCCGGCCATACCCAAAGCGAACCAGAGAGATTCAGCAGGAGGGAAAGTCGACGGCACCCCTCAAC
ATGTGGAGCGGCCCTCCCACCAGCGGCAACTCGACCCCCCTTCGCGAGAACATACCCGAATCCCCCACCGACGGC
TTCCCCGACTTTGCCCAGCTGCCGACGCCCGAGAGCCTGCCGCCGACCAGGAGGGCCCGCGCCGGCACCGTCCCC
TCCCGCTTCTCCCCCGGCGGCCCGCTCAGCGTCCAGAGCCTGGCTCCAAAGTCGGCCCGCGCCACCCCGTCCGCC
CCGACGCCCTTCAACAAGTCCCAGTCGCCCTCCCCGAGCCTCGACCCGCCCGAGGGCTCCTCCTCGTCCGGCTCG
GCCCTCCTGTCCCGCCTCCGGGCGGGCTCCATGCCCCAGCGCAGCCCCTTTGCCCCCGCGCCCGCCACCGCCGCC
CCTGCCGGCTCGCCTTTTGGCCCTTCCATCTTCAGCACCGGCTGGAACCCGGCTGGCGTCGGCCGTGAGCGGGGC
TCCACCCTCGCCAGCATCGCCAGCGTCGGTTCCAACGGGCCCAGCTCCCCGGCCCAGTCCCAGTTCTCCTCCAAG
GAGGCCGTTGGCGAGTCCGACGGCCCAGCTCGCCACGCCCTACATGGCCAACTTTGA
Transcript >Ophun1|2376
ATGGCGCCTGGCTATTCTCCGCGCCGCTCCGCCCCCCAAACTCGCTCGCAATCACCCTCTGCCGAAGCCAGAGCT
CATTACGCCCTCAGTCACAACGGCATCATGGCCGCCAACTCGCGATCCGGGGCTGGTTCTCCGTCGCACGAAATG
TCCGGCTCGGGCCGGCCATACCCAAAGCGAACCAGAGAGATTCAGCAGGAGGGAAAGTCGACGGCACCCCTCAAC
ATGTGGAGCGGCCCTCCCACCAGCGGCAACTCGACCCCCCTTCGCGAGAACATACCCGAATCCCCCACCGACGGC
TTCCCCGACTTTGCCCAGCTGCCGACGCCCGAGAGCCTGCCGCCGACCAGGAGGGCCCGCGCCGGCACCGTCCCC
TCCCGCTTCTCCCCCGGCGGCCCGCTCAGCGTCCAGAGCCTGGCTCCAAAGTCGGCCCGCGCCACCCCGTCCGCC
CCGACGCCCTTCAACAAGTCCCAGTCGCCCTCCCCGAGCCTCGACCCGCCCGAGGGCTCCTCCTCGTCCGGCTCG
GCCCTCCTGTCCCGCCTCCGGGCGGGCTCCATGCCCCAGCGCAGCCCCTTTGCCCCCGCGCCCGCCACCGCCGCC
CCTGCCGGCTCGCCTTTTGGCCCTTCCATCTTCAGCACCGGCTGGAACCCGGCTGGCGTCGGCCGTGAGCGGGGC
TCCACCCTCGCCAGCATCGCCAGCGTCGGTTCCAACGGGCCCAGCTCCCCGGCCCAGTCCCAGTTCTCCTCCAAG
GAGGCCGTTGGCGAGTCCGACGGCCCAGCTCGCCACGCCCTACATGGCCAACTTTGA
Gene >Ophun1|2376
ATGGCGCCTGGCTATTCTCCGCGCCGCTCCGCCCCCCAAACTCGCTCGCAATCACCCTCTGCCGAAGCCAGAGCT
CATTACGCCCTCAGTCACAACGGCATCATGGCCGCCAACTCGCGATCCGGGGCTGGTTCTCCGTCGCACGAAATG
TCCGGCTCGGGCCGGCCATACCCAAAGCGGTTCGCCCAATTCCCCCGGCCCCCTTTTTCCCTCTCTTCCACGGCC
CGAATCCGACTGACCCCGGACAGAACCAGAGAGATTCAGCAGGAGGGAAAGTCGACGGCACCCCTCAACATGTGG
AGCGGCCCTCCCACCAGCGGCAACTCGACCCCCCTTCGCGAGAACATACCCGAATCCCCCACCGACGGCTTCCCC
GACTTTGCCCAGCTGCCGACGCCCGAGAGCCTGCCGCCGACCAGGAGGGCCCGCGCCGGCACCGTCCCCTCCCGC
TTCTCCCCCGGCGGCCCGCTCAGCGTCCAGAGCCTGGCTCCAAAGTCGGCCCGCGCCACCCCGTCCGCCCCGACG
CCCTTCAACAAGTCCCAGTCGCCCTCCCCGAGCCTCGACCCGCCCGAGGGCTCCTCCTCGTCCGGCTCGGCCCTC
CTGTCCCGCCTCCGGGCGGGCTCCATGCCCCAGCGCAGCCCCTTTGCCCCCGCGCCCGCCACCGCCGCCCCTGCC
GGCTCGCCTTTTGGCCCTTCCATCTTCAGCACCGGCTGGAACCCGGCTGGCGTCGGCCGTGAGCGGGGCTCCACC
CTCGCCAGCATCGCCAGCGTCGGTTCCAACGGGCCCAGCTCCCCGGCCCAGTCCCAGTTCTCCTCCAAGGAGGCC
GTTGGCGAGTCCGACGTGCACATGCGAACCCTCGACTACCTCGGCCTGGCCGAGACGCCGCAGCCGCCCCCCAGG
GCCCAGCTCGCCACGCCCTACATGGCCAACTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail