Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2375
Gene name
LocationContig_216:25990..27319
Strand+
Gene length (bp)1329
Transcript length (bp)1257
Coding sequence length (bp)1257
Protein length (aa) 419

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01793 Glyco_transf_15 Glycolipid 2-alpha-mannosyltransferase 5.8E-38 38 307

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38130|KTR3_YEAST Probable mannosyltransferase KTR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR3 PE=1 SV=1 42 336 6.0E-23
sp|P27810|KTR1_YEAST Alpha-1,2 mannosyltransferase KTR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR1 PE=1 SV=1 42 345 1.0E-22
sp|Q00310|MNT1_CANAL Glycolipid 2-alpha-mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNT1 PE=3 SV=1 42 334 3.0E-22
sp|O74546|OMH3_SCHPO O-glycoside alpha-1,2-mannosyltransferase homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh3 PE=3 SV=1 35 336 3.0E-21
sp|O60160|OMH1_SCHPO O-glycoside alpha-1,2-mannosyltransferase omh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh1 PE=3 SV=1 42 183 1.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38130|KTR3_YEAST Probable mannosyltransferase KTR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR3 PE=1 SV=1 42 336 6.0E-23
sp|P27810|KTR1_YEAST Alpha-1,2 mannosyltransferase KTR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR1 PE=1 SV=1 42 345 1.0E-22
sp|Q00310|MNT1_CANAL Glycolipid 2-alpha-mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNT1 PE=3 SV=1 42 334 3.0E-22
sp|O74546|OMH3_SCHPO O-glycoside alpha-1,2-mannosyltransferase homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh3 PE=3 SV=1 35 336 3.0E-21
sp|O60160|OMH1_SCHPO O-glycoside alpha-1,2-mannosyltransferase omh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh1 PE=3 SV=1 42 183 1.0E-20
sp|P27809|KRE2_YEAST Glycolipid 2-alpha-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRE2 PE=1 SV=1 41 221 2.0E-20
sp|P26725|YUR1_YEAST Probable mannosyltransferase YUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YUR1 PE=1 SV=1 43 306 3.0E-19
sp|Q96WW1|OMH5_SCHPO O-glycoside alpha-1,2-mannosyltransferase homolog 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh5 PE=3 SV=2 33 183 9.0E-19
sp|P46592|MNT2_CANAL Glycolipid 2-alpha-mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNT2 PE=3 SV=3 42 334 5.0E-18
sp|P33550|KTR2_YEAST Probable mannosyltransferase KTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR2 PE=3 SV=1 43 340 1.0E-17
sp|P38131|KTR4_YEAST Probable mannosyltransferase KTR4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR4 PE=1 SV=1 42 307 9.0E-16
sp|P87207|MNT3_CANAL Probable mannosyltransferase MNT3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNT3 PE=3 SV=1 26 208 3.0E-15
sp|P53966|KTR5_YEAST Probable mannosyltransferase KTR5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR5 PE=1 SV=1 43 307 5.0E-14
sp|O94565|OMH4_SCHPO O-glycoside alpha-1,2-mannosyltransferase homolog 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh4 PE=3 SV=2 39 183 7.0E-14
sp|P40504|KTR7_YEAST Probable mannosyltransferase KTR7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR7 PE=1 SV=1 43 183 5.0E-13
sp|O42944|OMH2_SCHPO O-glycoside alpha-1,2-mannosyltransferase homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh2 PE=3 SV=1 43 307 1.0E-12
sp|P54070|KTR6_YEAST Mannosyltransferase KTR6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR6 PE=1 SV=1 31 183 1.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0006486 protein glycosylation Yes
GO:0000030 mannosyltransferase activity Yes
GO:0016020 membrane Yes
GO:0043413 macromolecule glycosylation No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0070085 glycosylation No
GO:0016740 transferase activity No
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0043412 macromolecule modification No
GO:0110165 cellular anatomical entity No
GO:0036211 protein modification process No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0016758 hexosyltransferase activity No
GO:0016757 glycosyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2375
MSSGRGVNTVFRAWLVVWAWCCLVWYCCASPAVATSTDHPPRAVLVSFAEERDLAAVLSSVSQLEETFNNRYHYD
WVFFSTHPFSEDFRRLTSNATKATCVYEVISDELWSVPRGASDSTLQSVDEREMHDMVVRRWKSGRFARESRLKS
YDWFWTIEPGAQFIHDIDFDVFHIMRDHDIAYGSHQSGLDESYMHRLSQHAKSFLDENPSLANEEAEFSWLLESA
LGKGDDSSAPEVMAMGAQGDGMALDDWLLGGGDEDSVGSPVEVLASRLGGIYRSSLWPTFEVGSLVFLRSRSHQA
FLEYLEKVDESDMLVYSGGRRTVNASIFLPQKSVLHRGTLDQWLIKGPMPMPKPRFSLVRLVGDGPTGNKSRRSA
KRWELLAHDICRQGVMPGLRSGHTVIDERNFVLNKSQRGKMIM*
Coding >Ophun1|2375
ATGAGCAGTGGTCGAGGCGTGAATACGGTGTTTAGAGCCTGGCTCGTCGTCTGGGCCTGGTGCTGCCTAGTTTGG
TACTGCTGCGCGTCGCCTGCTGTCGCGACGTCGACTGACCACCCTCCTCGGGCGGTTCTCGTGTCGTTTGCCGAA
GAACGTGACCTGGCAGCCGTCCTGTCATCGGTCTCGCAGCTCGAAGAAACGTTCAACAACCGATACCATTACGAC
TGGGTCTTCTTCAGCACCCATCCCTTCAGTGAAGACTTTCGCCGCCTCACATCCAACGCGACAAAGGCTACCTGC
GTGTATGAGGTGATTAGCGATGAGCTCTGGAGCGTGCCGAGGGGCGCCTCTGACTCGACCCTGCAGTCGGTCGAC
GAGCGGGAAATGCACGACATGGTTGTCCGTCGTTGGAAGTCGGGCCGCTTCGCGAGAGAAAGCAGACTTAAGAGC
TATGACTGGTTCTGGACCATCGAACCAGGCGCGCAGTTCATCCACGATATCGACTTTGATGTTTTCCACATCATG
AGAGACCATGACATCGCCTATGGCTCTCACCAGAGCGGCCTGGATGAAAGCTACATGCACAGACTGTCACAGCAC
GCCAAGTCCTTCCTCGATGAAAATCCGAGCCTGGCCAACGAAGAGGCCGAGTTTTCGTGGCTGCTGGAGTCGGCC
CTTGGGAAAGGCGACGACTCGTCGGCCCCAGAGGTGATGGCGATGGGAGCGCAGGGCGATGGAATGGCGCTTGAT
GACTGGCTGCTAGGCGGCGGCGACGAGGACTCCGTGGGCTCTCCGGTAGAGGTGCTTGCTTCCAGGCTGGGCGGC
ATTTACAGGAGTAGTCTCTGGCCGACGTTTGAGGTGGGATCGCTGGTGTTTCTGCGTAGTCGGAGCCACCAAGCC
TTTCTGGAGTATCTCGAAAAGGTCGACGAATCGGACATGCTCGTCTACAGCGGCGGACGACGGACGGTCAACGCC
AGCATCTTCCTGCCGCAGAAGAGCGTACTTCATCGGGGGACGCTCGACCAGTGGCTGATCAAGGGGCCGATGCCG
ATGCCGAAGCCAAGATTCAGCCTGGTGCGCCTCGTGGGAGACGGCCCAACCGGCAACAAGTCTCGACGGAGCGCC
AAGCGATGGGAGCTTCTAGCTCACGATATCTGCCGACAGGGAGTCATGCCGGGGCTGCGATCAGGGCACACGGTC
ATCGACGAGCGAAACTTTGTGCTCAACAAGTCGCAGCGGGGGAAAATGATCATGTGA
Transcript >Ophun1|2375
ATGAGCAGTGGTCGAGGCGTGAATACGGTGTTTAGAGCCTGGCTCGTCGTCTGGGCCTGGTGCTGCCTAGTTTGG
TACTGCTGCGCGTCGCCTGCTGTCGCGACGTCGACTGACCACCCTCCTCGGGCGGTTCTCGTGTCGTTTGCCGAA
GAACGTGACCTGGCAGCCGTCCTGTCATCGGTCTCGCAGCTCGAAGAAACGTTCAACAACCGATACCATTACGAC
TGGGTCTTCTTCAGCACCCATCCCTTCAGTGAAGACTTTCGCCGCCTCACATCCAACGCGACAAAGGCTACCTGC
GTGTATGAGGTGATTAGCGATGAGCTCTGGAGCGTGCCGAGGGGCGCCTCTGACTCGACCCTGCAGTCGGTCGAC
GAGCGGGAAATGCACGACATGGTTGTCCGTCGTTGGAAGTCGGGCCGCTTCGCGAGAGAAAGCAGACTTAAGAGC
TATGACTGGTTCTGGACCATCGAACCAGGCGCGCAGTTCATCCACGATATCGACTTTGATGTTTTCCACATCATG
AGAGACCATGACATCGCCTATGGCTCTCACCAGAGCGGCCTGGATGAAAGCTACATGCACAGACTGTCACAGCAC
GCCAAGTCCTTCCTCGATGAAAATCCGAGCCTGGCCAACGAAGAGGCCGAGTTTTCGTGGCTGCTGGAGTCGGCC
CTTGGGAAAGGCGACGACTCGTCGGCCCCAGAGGTGATGGCGATGGGAGCGCAGGGCGATGGAATGGCGCTTGAT
GACTGGCTGCTAGGCGGCGGCGACGAGGACTCCGTGGGCTCTCCGGTAGAGGTGCTTGCTTCCAGGCTGGGCGGC
ATTTACAGGAGTAGTCTCTGGCCGACGTTTGAGGTGGGATCGCTGGTGTTTCTGCGTAGTCGGAGCCACCAAGCC
TTTCTGGAGTATCTCGAAAAGGTCGACGAATCGGACATGCTCGTCTACAGCGGCGGACGACGGACGGTCAACGCC
AGCATCTTCCTGCCGCAGAAGAGCGTACTTCATCGGGGGACGCTCGACCAGTGGCTGATCAAGGGGCCGATGCCG
ATGCCGAAGCCAAGATTCAGCCTGGTGCGCCTCGTGGGAGACGGCCCAACCGGCAACAAGTCTCGACGGAGCGCC
AAGCGATGGGAGCTTCTAGCTCACGATATCTGCCGACAGGGAGTCATGCCGGGGCTGCGATCAGGGCACACGGTC
ATCGACGAGCGAAACTTTGTGCTCAACAAGTCGCAGCGGGGGAAAATGATCATGTGA
Gene >Ophun1|2375
ATGAGCAGTGGTCGAGGCGTGAATACGGTGTTTAGAGCCTGGCTCGTCGTCTGGGCCTGGTGCTGCCTAGTTTGG
TACTGCTGCGCGTCGCCTGCTGTCGCGACGTCGACTGACCACCCTCCTCGGGCGGTTCTCGTGTCGTTTGCCGAA
GAACGTGACCTGGCAGCCGTCCTGTCATCGGTCTCGCAGCTCGAAGAAACGTTCAACAACCGATACCATTACGAC
TGGGTCTTCTTCAGCACCCATCCCTTCAGTGAAGACTTTCGCCGCCTCACATCCAACGCGACAAAGGCTACCTGC
GTGTATGAGGTGATTAGCGATGAGCTCTGGAGCGTGCCGAGGGGCGCCTCTGACTCGACCCTGCAGTCGGTCGAC
GAGCGGGAAATGCACGACATGGTTGTCCGTCGTTGGAAGTCGGGCCGCTTCGCGAGAGAAAGCAGACTTAAGAGC
TATGACTGGTTCTGGACCATCGAACCAGGCGTAAGCATCTTTCTGTTTGCTCTTTGCATGTCAGGCACCGCAGAG
GCGGGCTAACAAGAAGTGATGGTGCAGGCGCAGTTCATCCACGATATCGACTTTGATGTTTTCCACATCATGAGA
GACCATGACATCGCCTATGGCTCTCACCAGAGCGGCCTGGATGAAAGCTACATGCACAGACTGTCACAGCACGCC
AAGTCCTTCCTCGATGAAAATCCGAGCCTGGCCAACGAAGAGGCCGAGTTTTCGTGGCTGCTGGAGTCGGCCCTT
GGGAAAGGCGACGACTCGTCGGCCCCAGAGGTGATGGCGATGGGAGCGCAGGGCGATGGAATGGCGCTTGATGAC
TGGCTGCTAGGCGGCGGCGACGAGGACTCCGTGGGCTCTCCGGTAGAGGTGCTTGCTTCCAGGCTGGGCGGCATT
TACAGGAGTAGTCTCTGGCCGACGTTTGAGGTGGGATCGCTGGTGTTTCTGCGTAGTCGGAGCCACCAAGCCTTT
CTGGAGTATCTCGAAAAGGTCGACGAATCGGACATGCTCGTCTACAGCGGCGGACGACGGACGGTCAACGCCAGC
ATCTTCCTGCCGCAGAAGAGCGTACTTCATCGGGGGACGCTCGACCAGTGGCTGATCAAGGGGCCGATGCCGATG
CCGAAGCCAAGATTCAGCCTGGTGCGCCTCGTGGGAGACGGCCCAACCGGCAACAAGTCTCGACGGAGCGCCAAG
CGATGGGAGCTTCTAGCTCACGATATCTGCCGACAGGGAGTCATGCCGGGGCTGCGATCAGGGCACACGGTCATC
GACGAGCGAAACTTTGTGCTCAACAAGTCGCAGCGGGGGAAAATGATCATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail