Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2368
Gene name
LocationContig_216:9187..9688
Strand+
Gene length (bp)501
Transcript length (bp)501
Coding sequence length (bp)501
Protein length (aa) 167

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01476 LysM LysM domain 2.3E-08 122 165

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 84 106 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6877
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|01348
Ophiocordyceps camponoti-rufipedis Ophun1|2368 (this protein)
Ophiocordyceps kimflemingae Ophio5|7594

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2368
MPDSDDDRLPEGMTRIGYDADSQIYTFQDADGSYWESAPGCRHGRLTRVGDCGQDPEQQQQQQPFLQDHRRQPFV
SWRHELMPLLNFGLLIGLSLLLLFWYLHWAADDSSPAAPSQCAGPPYVVRPGDTCWAIARARRLSVQDVVARNPS
LDCRRLVVGALLCLPP*
Coding >Ophun1|2368
ATGCCAGACTCCGACGACGACCGCCTCCCCGAAGGCATGACGCGGATCGGATACGACGCCGACTCCCAAATCTAC
ACCTTCCAAGACGCCGACGGCTCATACTGGGAATCCGCCCCGGGCTGCCGCCACGGCCGCCTCACCCGCGTTGGC
GACTGCGGCCAAGATCCCGAGCAGCAGCAGCAGCAGCAGCCATTCCTCCAAGACCACCGCCGCCAACCCTTCGTC
TCGTGGCGCCACGAGCTGATGCCCCTGCTCAATTTCGGCCTCCTCATCGGTCTCAGCCTCCTCCTCCTCTTCTGG
TACCTCCACTGGGCCGCCGACGATTCCTCCCCGGCGGCCCCTAGCCAGTGCGCCGGCCCGCCCTACGTCGTCCGC
CCGGGCGACACCTGCTGGGCCATCGCCCGCGCCAGACGCCTCTCTGTCCAAGACGTCGTCGCCCGAAACCCCTCC
CTCGACTGTCGCCGTCTGGTCGTTGGTGCCCTGCTGTGTCTGCCGCCTTGA
Transcript >Ophun1|2368
ATGCCAGACTCCGACGACGACCGCCTCCCCGAAGGCATGACGCGGATCGGATACGACGCCGACTCCCAAATCTAC
ACCTTCCAAGACGCCGACGGCTCATACTGGGAATCCGCCCCGGGCTGCCGCCACGGCCGCCTCACCCGCGTTGGC
GACTGCGGCCAAGATCCCGAGCAGCAGCAGCAGCAGCAGCCATTCCTCCAAGACCACCGCCGCCAACCCTTCGTC
TCGTGGCGCCACGAGCTGATGCCCCTGCTCAATTTCGGCCTCCTCATCGGTCTCAGCCTCCTCCTCCTCTTCTGG
TACCTCCACTGGGCCGCCGACGATTCCTCCCCGGCGGCCCCTAGCCAGTGCGCCGGCCCGCCCTACGTCGTCCGC
CCGGGCGACACCTGCTGGGCCATCGCCCGCGCCAGACGCCTCTCTGTCCAAGACGTCGTCGCCCGAAACCCCTCC
CTCGACTGTCGCCGTCTGGTCGTTGGTGCCCTGCTGTGTCTGCCGCCTTGA
Gene >Ophun1|2368
ATGCCAGACTCCGACGACGACCGCCTCCCCGAAGGCATGACGCGGATCGGATACGACGCCGACTCCCAAATCTAC
ACCTTCCAAGACGCCGACGGCTCATACTGGGAATCCGCCCCGGGCTGCCGCCACGGCCGCCTCACCCGCGTTGGC
GACTGCGGCCAAGATCCCGAGCAGCAGCAGCAGCAGCAGCCATTCCTCCAAGACCACCGCCGCCAACCCTTCGTC
TCGTGGCGCCACGAGCTGATGCCCCTGCTCAATTTCGGCCTCCTCATCGGTCTCAGCCTCCTCCTCCTCTTCTGG
TACCTCCACTGGGCCGCCGACGATTCCTCCCCGGCGGCCCCTAGCCAGTGCGCCGGCCCGCCCTACGTCGTCCGC
CCGGGCGACACCTGCTGGGCCATCGCCCGCGCCAGACGCCTCTCTGTCCAAGACGTCGTCGCCCGAAACCCCTCC
CTCGACTGTCGCCGTCTGGTCGTTGGTGCCCTGCTGTGTCTGCCGCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail