Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2367
Gene name
LocationContig_216:7646..8749
Strand-
Gene length (bp)1103
Transcript length (bp)984
Coding sequence length (bp)984
Protein length (aa) 328

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 1.3E-36 6 214
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 1.4E-09 15 91
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 8.1E-14 116 213

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09851|AYR1_SCHPO NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ayr1 PE=3 SV=2 1 282 2.0E-39
sp|P40471|AYR1_YEAST NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AYR1 PE=1 SV=1 4 297 2.0E-27
sp|Q62730|DHB2_RAT Estradiol 17-beta-dehydrogenase 2 OS=Rattus norvegicus GN=Hsd17b2 PE=2 SV=1 4 217 3.0E-19
sp|Q9KWN1|SDH_RHIRD Serine 3-dehydrogenase OS=Rhizobium radiobacter GN=sdh PE=1 SV=1 6 208 5.0E-18
sp|Q8U8I2|SDH_AGRFC Serine 3-dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=sdh PE=3 SV=1 6 208 1.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09851|AYR1_SCHPO NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ayr1 PE=3 SV=2 1 282 2.0E-39
sp|P40471|AYR1_YEAST NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AYR1 PE=1 SV=1 4 297 2.0E-27
sp|Q62730|DHB2_RAT Estradiol 17-beta-dehydrogenase 2 OS=Rattus norvegicus GN=Hsd17b2 PE=2 SV=1 4 217 3.0E-19
sp|Q9KWN1|SDH_RHIRD Serine 3-dehydrogenase OS=Rhizobium radiobacter GN=sdh PE=1 SV=1 6 208 5.0E-18
sp|Q8U8I2|SDH_AGRFC Serine 3-dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=sdh PE=3 SV=1 6 208 1.0E-17
sp|P54554|YQJQ_BACSU Uncharacterized oxidoreductase YqjQ OS=Bacillus subtilis (strain 168) GN=yqjQ PE=3 SV=1 7 216 3.0E-17
sp|P51658|DHB2_MOUSE Estradiol 17-beta-dehydrogenase 2 OS=Mus musculus GN=Hsd17b2 PE=1 SV=2 4 295 1.0E-16
sp|O54753|H17B6_RAT 17-beta-hydroxysteroid dehydrogenase type 6 OS=Rattus norvegicus GN=Hsd17b6 PE=1 SV=2 7 210 5.0E-15
sp|O16881|DHS16_CAEEL 3 beta-hydroxysteroid dehydrogenase dhs-16 OS=Caenorhabditis elegans GN=dhs-16 PE=2 SV=1 7 296 3.0E-14
sp|P0AFP4|YBBO_ECOLI Uncharacterized oxidoreductase YbbO OS=Escherichia coli (strain K12) GN=ybbO PE=3 SV=1 4 228 5.0E-14
sp|P0AFP5|YBBO_ECOL6 Uncharacterized oxidoreductase YbbO OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ybbO PE=3 SV=1 4 228 5.0E-14
sp|Q9R092|H17B6_MOUSE 17-beta-hydroxysteroid dehydrogenase type 6 OS=Mus musculus GN=Hsd17b6 PE=1 SV=1 7 240 6.0E-14
sp|O74628|YQ53_SCHPO Uncharacterized oxidoreductase C162.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC162.03 PE=3 SV=1 5 247 2.0E-13
sp|Q0IH28|DRS7B_XENLA Dehydrogenase/reductase SDR family member 7B OS=Xenopus laevis GN=dhrs7b PE=2 SV=1 7 210 4.0E-13
sp|Q3T001|H17B6_BOVIN 17-beta-hydroxysteroid dehydrogenase type 6 OS=Bos taurus GN=HSD17B6 PE=2 SV=1 7 234 5.0E-13
sp|Q02337|BDH_BOVIN D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Bos taurus GN=BDH1 PE=1 SV=2 7 204 5.0E-13
sp|P29147|BDH_RAT D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Bdh1 PE=1 SV=2 2 204 7.0E-13
sp|O05730|VDLC_HELPY Probable short-chain type dehydrogenase/reductase VdlC OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=vdlC PE=3 SV=2 4 255 7.0E-13
sp|P37059|DHB2_HUMAN Estradiol 17-beta-dehydrogenase 2 OS=Homo sapiens GN=HSD17B2 PE=1 SV=1 4 217 7.0E-13
sp|P69936|YDFG_SALTY NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ydfG PE=3 SV=1 7 216 7.0E-13
sp|P69935|YDFG_SALTI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhi GN=ydfG PE=3 SV=1 7 216 7.0E-13
sp|P9WGR5|Y484_MYCTU Uncharacterized oxidoreductase Rv0484c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0484c PE=1 SV=1 3 247 9.0E-13
sp|P9WGR4|Y484_MYCTO Uncharacterized oxidoreductase MT0502 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0502 PE=3 SV=1 3 247 9.0E-13
sp|Q0VFE7|DRS7B_XENTR Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis GN=dhrs7b PE=2 SV=1 7 210 1.0E-12
sp|Q80XN0|BDH_MOUSE D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Mus musculus GN=Bdh1 PE=1 SV=2 2 204 1.0E-12
sp|P37959|YUSZ_BACSU Uncharacterized oxidoreductase YusZ OS=Bacillus subtilis (strain 168) GN=yusZ PE=3 SV=2 3 236 1.0E-12
sp|O32291|YXNA_BACSU Uncharacterized oxidoreductase YxnA OS=Bacillus subtilis (strain 168) GN=yxnA PE=3 SV=2 7 218 6.0E-12
sp|O14756|H17B6_HUMAN 17-beta-hydroxysteroid dehydrogenase type 6 OS=Homo sapiens GN=HSD17B6 PE=1 SV=1 7 210 7.0E-12
sp|Q9STY7|HSD3_ARATH 11-beta-hydroxysteroid dehydrogenase-like 3 OS=Arabidopsis thaliana GN=HSD3 PE=3 SV=1 1 210 8.0E-12
sp|Q2FVD5|Y2778_STAA8 Uncharacterized oxidoreductase SAOUHSC_02778 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02778 PE=3 SV=1 8 235 9.0E-12
sp|Q5HD73|Y2488_STAAC Uncharacterized oxidoreductase SACOL2488 OS=Staphylococcus aureus (strain COL) GN=SACOL2488 PE=3 SV=1 8 235 9.0E-12
sp|Q2FE21|Y2422_STAA3 Uncharacterized oxidoreductase SAUSA300_2422 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2422 PE=3 SV=1 8 235 9.0E-12
sp|Q9P7B4|YI13_SCHPO NADP-dependent 3-hydroxy acid dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.03 PE=1 SV=1 6 221 9.0E-12
sp|Q6GDV6|Y2567_STAAR Uncharacterized oxidoreductase SAR2567 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2567 PE=3 SV=1 8 235 1.0E-11
sp|Q83RE8|YDFG_SHIFL NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Shigella flexneri GN=ydfG PE=3 SV=2 7 215 2.0E-11
sp|Q8FHD2|YDFG_ECOL6 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ydfG PE=3 SV=2 7 215 2.0E-11
sp|P39831|YDFG_ECOLI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli (strain K12) GN=ydfG PE=1 SV=2 7 215 3.0E-11
sp|Q9N126|RDH8_BOVIN Retinol dehydrogenase 8 OS=Bos taurus GN=RDH8 PE=1 SV=1 6 210 3.0E-11
sp|Q8X505|YDFG_ECO57 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O157:H7 GN=ydfG PE=3 SV=1 7 215 3.0E-11
sp|Q9ZKW1|VDLC_HELPJ Probable short-chain type dehydrogenase/reductase VdlC OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=vdlC PE=3 SV=1 8 234 4.0E-11
sp|P55434|Y4EK_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4eK OS=Rhizobium sp. (strain NGR234) GN=NGR_a03840 PE=3 SV=1 1 212 5.0E-11
sp|Q8NUV9|Y2403_STAAW Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 8 235 5.0E-11
sp|Q6G6J1|Y2370_STAAS Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 8 235 5.0E-11
sp|Q99J47|DRS7B_MOUSE Dehydrogenase/reductase SDR family member 7B OS=Mus musculus GN=Dhrs7b PE=1 SV=1 3 244 7.0E-11
sp|Q9NYR8|RDH8_HUMAN Retinol dehydrogenase 8 OS=Homo sapiens GN=RDH8 PE=1 SV=1 2 209 8.0E-11
sp|Q9STY8|HSD2_ARATH 11-beta-hydroxysteroid dehydrogenase-like 2 OS=Arabidopsis thaliana GN=HSD2 PE=2 SV=1 7 210 8.0E-11
sp|Q02338|BDH_HUMAN D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Homo sapiens GN=BDH1 PE=1 SV=3 7 204 8.0E-11
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 8 235 9.0E-11
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 8 235 9.0E-11
sp|O88451|RDH7_MOUSE Retinol dehydrogenase 7 OS=Mus musculus GN=Rdh7 PE=1 SV=1 7 210 1.0E-10
sp|P0DKC6|HSD1B_ARATH 11-beta-hydroxysteroid dehydrogenase 1B OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 7 210 1.0E-10
sp|P0DKC5|HSD1A_ARATH 11-beta-hydroxysteroid dehydrogenase 1A OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 7 210 1.0E-10
sp|Q9BPW9|DHRS9_HUMAN Dehydrogenase/reductase SDR family member 9 OS=Homo sapiens GN=DHRS9 PE=1 SV=1 7 210 1.0E-10
sp|P50169|RDH3_RAT Retinol dehydrogenase 3 OS=Rattus norvegicus GN=Rdh3 PE=1 SV=1 7 248 2.0E-10
sp|Q8HYR6|DHRS9_BOVIN Dehydrogenase/reductase SDR family member 9 OS=Bos taurus GN=DHRS9 PE=2 SV=1 7 210 2.0E-10
sp|P51657|DHB1_RAT Estradiol 17-beta-dehydrogenase 1 OS=Rattus norvegicus GN=Hsd17b1 PE=1 SV=1 4 208 2.0E-10
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 8 215 4.0E-10
sp|Q3T0R4|DRS7B_BOVIN Dehydrogenase/reductase SDR family member 7B OS=Bos taurus GN=DHRS7B PE=2 SV=1 3 210 5.0E-10
sp|Q28IU1|DHB12_XENTR Very-long-chain 3-oxoacyl-CoA reductase OS=Xenopus tropicalis GN=hsd17b12 PE=2 SV=1 8 212 5.0E-10
sp|P55006|RDH7_RAT Retinol dehydrogenase 7 OS=Rattus norvegicus GN=Rdh7 PE=2 SV=1 7 210 6.0E-10
sp|Q49117|Y182_METEA Uncharacterized oxidoreductase MexAM1_META1p0182 OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=MexAM1_META1p0182 PE=3 SV=2 8 204 8.0E-10
sp|P51656|DHB1_MOUSE Estradiol 17-beta-dehydrogenase 1 OS=Mus musculus GN=Hsd17b1 PE=2 SV=1 5 212 9.0E-10
sp|P9WGS3|EPHD_MYCTU Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ephD PE=1 SV=1 5 210 1.0E-09
sp|P9WGS2|EPHD_MYCTO Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ephD PE=3 SV=1 5 210 1.0E-09
sp|P66778|EPHD_MYCBO Probable oxidoreductase EphD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ephD PE=3 SV=1 5 210 1.0E-09
sp|Q5E9H7|DHB12_BOVIN Very-long-chain 3-oxoacyl-CoA reductase OS=Bos taurus GN=HSD17B12 PE=2 SV=1 8 212 1.0E-09
sp|Q6P7R8|DHB12_RAT Very-long-chain 3-oxoacyl-CoA reductase OS=Rattus norvegicus GN=Hsd17b12 PE=2 SV=1 8 192 1.0E-09
sp|O70503|DHB12_MOUSE Very-long-chain 3-oxoacyl-CoA reductase OS=Mus musculus GN=Hsd17b12 PE=1 SV=1 8 192 1.0E-09
sp|Q6IAN0|DRS7B_HUMAN Dehydrogenase/reductase SDR family member 7B OS=Homo sapiens GN=DHRS7B PE=1 SV=2 3 210 2.0E-09
sp|Q6QLL4|DHI1_CAVPO Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Cavia porcellus GN=HSD11B1 PE=1 SV=3 1 208 2.0E-09
sp|Q5R6U1|DRS7B_PONAB Dehydrogenase/reductase SDR family member 7B OS=Pongo abelii GN=DHRS7B PE=2 SV=2 3 210 2.0E-09
sp|Q5XG41|DH12A_XENLA Very-long-chain 3-oxoacyl-CoA reductase-A OS=Xenopus laevis GN=hsd17b12-a PE=2 SV=1 8 190 2.0E-09
sp|Q9SY73|PTALR_ARATH NADPH-dependent pterin aldehyde reductase OS=Arabidopsis thaliana GN=At1g10310 PE=1 SV=1 6 196 2.0E-09
sp|P14061|DHB1_HUMAN Estradiol 17-beta-dehydrogenase 1 OS=Homo sapiens GN=HSD17B1 PE=1 SV=3 1 212 3.0E-09
sp|P16232|DHI1_RAT Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Rattus norvegicus GN=Hsd11b1 PE=1 SV=2 1 209 4.0E-09
sp|Q29608|DHI1_SAISC Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Saimiri sciureus GN=HSD11B1 PE=2 SV=3 1 209 5.0E-09
sp|Q7Z4W1|DCXR_HUMAN L-xylulose reductase OS=Homo sapiens GN=DCXR PE=1 SV=2 7 198 6.0E-09
sp|Q4R5G7|DHB12_MACFA Very-long-chain 3-oxoacyl-CoA reductase OS=Macaca fascicularis GN=HSD17B12 PE=2 SV=1 8 190 6.0E-09
sp|P28845|DHI1_HUMAN Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Homo sapiens GN=HSD11B1 PE=1 SV=3 1 209 7.0E-09
sp|P0CR34|MKAR_CRYNJ Very-long-chain 3-oxoacyl-CoA reductase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNI00690 PE=3 SV=1 4 224 1.0E-08
sp|P0CR35|MKAR_CRYNB Very-long-chain 3-oxoacyl-CoA reductase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBH0660 PE=3 SV=1 4 224 1.0E-08
sp|Q8AVY8|DH12B_XENLA Very-long-chain 3-oxoacyl-CoA reductase-B OS=Xenopus laevis GN=hsd17b12-b PE=2 SV=1 8 212 1.0E-08
sp|Q1WNP0|DHB1_PANTR Estradiol 17-beta-dehydrogenase 1 OS=Pan troglodytes GN=HSD17B1 PE=3 SV=3 1 212 1.0E-08
sp|Q6P3L6|DH12A_DANRE Very-long-chain 3-oxoacyl-CoA reductase-A OS=Danio rerio GN=hsd17b12a PE=2 SV=1 8 228 2.0E-08
sp|P50233|DHI2_RAT Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Rattus norvegicus GN=Hsd11b2 PE=1 SV=1 7 321 2.0E-08
sp|Q5RJY4|DRS7B_RAT Dehydrogenase/reductase SDR family member 7B OS=Rattus norvegicus GN=Dhrs7b PE=1 SV=1 3 244 2.0E-08
sp|Q7M3I4|DHI1_RABIT Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Oryctolagus cuniculus GN=HSD11B1 PE=1 SV=2 1 209 2.0E-08
sp|P45200|Y1430_HAEIN Probable NADP-dependent dehydrogenase HI_1430 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1430 PE=3 SV=1 3 204 2.0E-08
sp|P80365|DHI2_HUMAN Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Homo sapiens GN=HSD11B2 PE=1 SV=2 7 326 3.0E-08
sp|P50172|DHI1_MOUSE Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Mus musculus GN=Hsd11b1 PE=1 SV=3 1 209 3.0E-08
sp|Q6PUF4|DHI1L_CHICK Hydroxysteroid 11-beta-dehydrogenase 1-like protein OS=Gallus gallus GN=HSD11B1L PE=2 SV=1 7 209 4.0E-08
sp|Q5HLD8|Y2049_STAEQ Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1 3 215 5.0E-08
sp|Q8CN40|Y2036_STAES Uncharacterized oxidoreductase SE_2036 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2036 PE=3 SV=1 3 215 5.0E-08
sp|O57314|DHB12_ANAPL Very-long-chain 3-oxoacyl-CoA reductase OS=Anas platyrhynchos GN=HSD17B12 PE=2 SV=1 8 227 5.0E-08
sp|O77667|DHI2_BOVIN Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Bos taurus GN=HSD11B2 PE=1 SV=1 7 213 5.0E-08
sp|C1C4R8|BDH2_LITCT 3-hydroxybutyrate dehydrogenase type 2 OS=Lithobates catesbeiana GN=bdh2 PE=2 SV=1 7 208 5.0E-08
sp|Q58NB6|DHRS9_MOUSE Dehydrogenase/reductase SDR family member 9 OS=Mus musculus GN=Dhrs9 PE=2 SV=2 7 210 5.0E-08
sp|Q91XV4|DCXR_MESAU L-xylulose reductase OS=Mesocricetus auratus GN=DCXR PE=1 SV=1 8 198 5.0E-08
sp|Q53GQ0|DHB12_HUMAN Very-long-chain 3-oxoacyl-CoA reductase OS=Homo sapiens GN=HSD17B12 PE=1 SV=2 8 190 5.0E-08
sp|Q1JP75|DCXR_BOVIN L-xylulose reductase OS=Bos taurus GN=DCXR PE=2 SV=1 8 198 6.0E-08
sp|Q27979|RDH1_BOVIN 11-cis retinol dehydrogenase OS=Bos taurus GN=RDH5 PE=1 SV=1 7 210 8.0E-08
sp|Q5ZJZ5|BDH_CHICK D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Gallus gallus GN=BDH1 PE=2 SV=1 42 214 9.0E-08
sp|P05406|FIXR_BRADU Protein FixR OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fixR PE=3 SV=2 7 214 1.0E-07
sp|Q7Q732|DHRS7_ANOGA Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3 7 208 1.0E-07
sp|Q8VD48|DHRS9_RAT Dehydrogenase/reductase SDR family member 9 OS=Rattus norvegicus GN=Dhrs9 PE=2 SV=1 7 210 1.0E-07
sp|Q7Z9I2|YCP9_SCHPO Uncharacterized oxidoreductase C663.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.09c PE=3 SV=1 1 213 1.0E-07
sp|P39483|DHG2_BACME Glucose 1-dehydrogenase 2 OS=Bacillus megaterium GN=gdhII PE=3 SV=1 3 210 2.0E-07
sp|Q59787|DHSO_RHOSH Sorbitol dehydrogenase OS=Rhodobacter sphaeroides GN=polS PE=1 SV=1 6 207 2.0E-07
sp|Q920P0|DCXR_RAT L-xylulose reductase OS=Rattus norvegicus GN=Dcxr PE=1 SV=1 8 198 3.0E-07
sp|P50168|DHI2_SHEEP Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Ovis aries GN=HSD11B2 PE=2 SV=1 7 213 4.0E-07
sp|Q91X52|DCXR_MOUSE L-xylulose reductase OS=Mus musculus GN=Dcxr PE=1 SV=2 8 198 5.0E-07
sp|O55240|RDH1_MOUSE 11-cis retinol dehydrogenase OS=Mus musculus GN=Rdh5 PE=1 SV=1 7 210 7.0E-07
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 7 210 9.0E-07
sp|Q1DNC5|MKAR_COCIM Very-long-chain 3-oxoacyl-CoA reductase OS=Coccidioides immitis (strain RS) GN=CIMG_08188 PE=3 SV=2 8 201 1.0E-06
sp|P42317|YXJF_BACSU Uncharacterized oxidoreductase YxjF OS=Bacillus subtilis (strain 168) GN=yxjF PE=3 SV=2 3 235 1.0E-06
sp|A4IFA7|CBR4_BOVIN Carbonyl reductase family member 4 OS=Bos taurus GN=CBR4 PE=2 SV=1 16 235 1.0E-06
sp|Q4L8Y1|Y0585_STAHJ Uncharacterized oxidoreductase SH0585 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0585 PE=3 SV=1 8 215 1.0E-06
sp|Q9LUE4|HSD6_ARATH 11-beta-hydroxysteroid dehydrogenase-like 6 OS=Arabidopsis thaliana GN=HSD6 PE=2 SV=1 6 232 1.0E-06
sp|Q6R0J2|DHI1_MESAU Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Mesocricetus auratus GN=HSD11B1 PE=1 SV=3 1 209 1.0E-06
sp|Q9BTZ2|DHRS4_HUMAN Dehydrogenase/reductase SDR family member 4 OS=Homo sapiens GN=DHRS4 PE=1 SV=3 8 209 1.0E-06
sp|Q8JIS3|DER_CHICK D-erythrulose reductase OS=Gallus gallus GN=DER PE=1 SV=1 3 210 2.0E-06
sp|Q92781|RDH1_HUMAN 11-cis retinol dehydrogenase OS=Homo sapiens GN=RDH5 PE=1 SV=1 2 210 2.0E-06
sp|Q9PKF7|FABG_CHLMU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fabG PE=3 SV=1 8 212 3.0E-06
sp|Q29529|CBR2_PIG Carbonyl reductase [NADPH] 2 OS=Sus scrofa GN=CBR2 PE=1 SV=1 8 198 4.0E-06
sp|Q561X9|BDH2_DANRE 3-hydroxybutyrate dehydrogenase type 2 OS=Danio rerio GN=bdh2 PE=2 SV=1 7 208 5.0E-06
sp|Q6Q7D1|DHI1L_BOVIN Hydroxysteroid 11-beta-dehydrogenase 1-like protein OS=Bos taurus GN=HSD11B1L PE=2 SV=1 7 200 7.0E-06
sp|Q3ZBV9|DHR11_BOVIN Dehydrogenase/reductase SDR family member 11 OS=Bos taurus GN=DHRS11 PE=2 SV=1 3 215 9.0E-06
sp|Q6P0H7|CBR4_DANRE Carbonyl reductase family member 4 OS=Danio rerio GN=cbr4 PE=2 SV=1 111 210 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 148 170 22
2 275 297 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2367
MARKTTVLITGCTPGGIGHALALEFHKRGCHVIATARRPEVLVDLGSMGISTLQLDVTDEESVARCRAEAGALLV
DGKLDVLVNNACVHSLNHIEKGNIWHEDSRRGEYRGVFRAVPALDHETESAKAMFDVNVFGLMRMCKAFVDLLIP
ARGLIVNVSSVCAILPAIFLSVYSSCKAAVDQYTAVLRQELEPLHVRIMLIQAGGVDTNIFKDDDSFLPTDSRYT
AARDVYDSFICTFRDIVQTTPSDRFAARVVGAALKGEPRLAGLLGGTPDCLWYGGLTFSTWVYQLSFVPTWVRRL
MLNAFLRNRRMIRLIREADVGNKLHQS*
Coding >Ophun1|2367
ATGGCGCGCAAGACGACGGTCCTCATCACGGGGTGTACCCCCGGCGGTATCGGCCACGCGCTGGCCCTCGAGTTC
CACAAGCGCGGATGCCATGTCATCGCCACCGCCCGCCGTCCCGAGGTGCTCGTCGATCTGGGTTCCATGGGTATC
AGCACCCTTCAGCTGGACGTGACGGACGAAGAGAGCGTGGCCCGGTGCCGAGCCGAGGCTGGGGCTCTGCTGGTG
GACGGCAAGCTCGACGTGCTGGTCAACAATGCGTGCGTTCATTCCCTCAATCACATAGAGAAAGGCAATATCTGG
CATGAGGACTCACGGAGAGGTGAGTACAGGGGTGTCTTCCGCGCGGTACCCGCCCTTGACCATGAAACGGAATCG
GCCAAGGCCATGTTCGACGTCAACGTCTTCGGCCTGATGCGCATGTGCAAGGCCTTTGTCGACTTGCTCATCCCA
GCCCGTGGCCTCATCGTCAACGTTTCATCCGTCTGCGCCATCCTACCCGCCATCTTCTTGAGCGTGTATTCTTCA
TGCAAGGCGGCCGTCGACCAGTACACGGCGGTGCTGCGTCAGGAGTTGGAGCCCTTGCACGTCCGCATTATGCTG
ATCCAGGCTGGTGGTGTTGACACCAACATCTTTAAAGATGATGATTCTTTCCTGCCGACCGACTCGCGCTACACT
GCTGCTCGCGACGTCTACGACTCCTTCATCTGCACCTTCAGGGATATTGTCCAGACCACGCCTTCCGATCGCTTT
GCTGCCCGCGTCGTCGGCGCTGCCCTCAAGGGCGAGCCACGGCTGGCCGGTCTGCTTGGAGGCACGCCTGATTGT
CTCTGGTACGGTGGTCTGACCTTTAGTACTTGGGTCTATCAACTTAGTTTCGTCCCTACCTGGGTTCGACGGCTT
ATGCTCAACGCTTTCTTGCGTAACCGACGCATGATAAGGCTTATTCGAGAGGCCGATGTGGGAAACAAGCTGCAT
CAATCATAG
Transcript >Ophun1|2367
ATGGCGCGCAAGACGACGGTCCTCATCACGGGGTGTACCCCCGGCGGTATCGGCCACGCGCTGGCCCTCGAGTTC
CACAAGCGCGGATGCCATGTCATCGCCACCGCCCGCCGTCCCGAGGTGCTCGTCGATCTGGGTTCCATGGGTATC
AGCACCCTTCAGCTGGACGTGACGGACGAAGAGAGCGTGGCCCGGTGCCGAGCCGAGGCTGGGGCTCTGCTGGTG
GACGGCAAGCTCGACGTGCTGGTCAACAATGCGTGCGTTCATTCCCTCAATCACATAGAGAAAGGCAATATCTGG
CATGAGGACTCACGGAGAGGTGAGTACAGGGGTGTCTTCCGCGCGGTACCCGCCCTTGACCATGAAACGGAATCG
GCCAAGGCCATGTTCGACGTCAACGTCTTCGGCCTGATGCGCATGTGCAAGGCCTTTGTCGACTTGCTCATCCCA
GCCCGTGGCCTCATCGTCAACGTTTCATCCGTCTGCGCCATCCTACCCGCCATCTTCTTGAGCGTGTATTCTTCA
TGCAAGGCGGCCGTCGACCAGTACACGGCGGTGCTGCGTCAGGAGTTGGAGCCCTTGCACGTCCGCATTATGCTG
ATCCAGGCTGGTGGTGTTGACACCAACATCTTTAAAGATGATGATTCTTTCCTGCCGACCGACTCGCGCTACACT
GCTGCTCGCGACGTCTACGACTCCTTCATCTGCACCTTCAGGGATATTGTCCAGACCACGCCTTCCGATCGCTTT
GCTGCCCGCGTCGTCGGCGCTGCCCTCAAGGGCGAGCCACGGCTGGCCGGTCTGCTTGGAGGCACGCCTGATTGT
CTCTGGTACGGTGGTCTGACCTTTAGTACTTGGGTCTATCAACTTAGTTTCGTCCCTACCTGGGTTCGACGGCTT
ATGCTCAACGCTTTCTTGCGTAACCGACGCATGATAAGGCTTATTCGAGAGGCCGATGTGGGAAACAAGCTGCAT
CAATCATAG
Gene >Ophun1|2367
ATGGCGCGCAAGACGACGGTCCTCATCACGGGGTAAGTGGCAGATGGCACCAAGAATCGCTGGGGAAGAGGCTCA
GGGGAAGCTTTCAGGTGTACCCCCGGCGGTATCGGCCACGCGCTGGCCCTCGAGTTCCACAAGCGCGGTGGGTGG
CCCCCAGTGAGGTCAAGATCTCTCTCTGACCAGAGCCATCTGCCCATCTATCAGGATGCCATGTCATCGCCACCG
CCCGCCGTCCCGAGGTGCTCGTCGATCTGGGTTCCATGGGTATCAGCACCCTTCAGCTGGACGTGACGGACGAAG
AGAGCGTGGCCCGGTGCCGAGCCGAGGCTGGGGCTCTGCTGGTGGACGGCAAGCTCGACGTGCTGGTCAACAATG
CGTGCGTTCATTCCCTCAATCACATAGAGAAAGGCAATATCTGGCATGAGGACTCACGGAGAGGTGAGTACAGGG
GTGTCTTCCGCGCGGTACCCGCCCTTGACCATGAAACGGAATCGGCCAAGGCCATGTTCGACGTCAACGTCTTCG
GCCTGATGCGCATGTGCAAGGCCTTTGTCGACTTGCTCATCCCAGCCCGTGGCCTCATCGTCAACGTTTCATCCG
TCTGCGCCATCCTACCCGCCATCTTCTTGAGCGTGTATTCTTCATGCAAGGCGGCCGTCGACCAGTACACGGCGG
TGCTGCGTCAGGAGTTGGAGCCCTTGCACGTCCGCATTATGCTGATCCAGGCTGGTGGTGTTGACACCAACATCT
TTAAAGATGATGATTCTTTCCTGCCGACCGACTCGCGCTACACTGCTGCTCGCGACGTCTACGACTCCTTCATCT
GCACCTTCAGGGATATTGTCCAGACCACGCCTTCCGATCGCTTTGCTGCCCGCGTCGTCGGCGCTGCCCTCAAGG
GCGAGCCACGGCTGGCCGGTCTGCTTGGAGGCACGCCTGATTGTCTCTGGTACGGTGGTCTGACCTTTAGTACTT
GGGTCTATCAACTTAGTTTCGTCCCTACCTGGGTTCGACGGCTTATGCTCAACGCTTTCTTGCGTAACCGACGCA
TGATAAGGCTTATTCGAGAGGCCGATGTGGGAAACAAGCTGCATCAATCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail