Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2366
Gene name
LocationContig_216:5949..7568
Strand+
Gene length (bp)1619
Transcript length (bp)1563
Coding sequence length (bp)1563
Protein length (aa) 521

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12756 zf-C2H2_2 C2H2 type zinc-finger (2 copies) 5.8E-28 202 298
PF12874 zf-met Zinc-finger of C2H2 type 5.4E-05 77 100
PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding 2.5E-05 78 101

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G0S920|REI1_CHATD Cytoplasmic 60S subunit biogenesis factor REI1 homolog OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0044240 PE=3 SV=2 2 510 1.0E-149
sp|O59811|REI1_SCHPO Cytoplasmic 60S subunit biogenesis factor SPCC550.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.15c PE=1 SV=1 8 405 5.0E-66
sp|Q06709|REH1_YEAST Cytoplasmic 60S subunit biogenesis factor REH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REH1 PE=1 SV=1 172 435 1.0E-28
sp|P38344|REI1_YEAST Cytoplasmic 60S subunit biogenesis factor REI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REI1 PE=1 SV=3 202 433 2.0E-28
sp|Q91VY9|ZN622_MOUSE Zinc finger protein 622 OS=Mus musculus GN=Znf622 PE=1 SV=1 175 405 5.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G0S920|REI1_CHATD Cytoplasmic 60S subunit biogenesis factor REI1 homolog OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0044240 PE=3 SV=2 2 510 1.0E-149
sp|O59811|REI1_SCHPO Cytoplasmic 60S subunit biogenesis factor SPCC550.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.15c PE=1 SV=1 8 405 5.0E-66
sp|Q06709|REH1_YEAST Cytoplasmic 60S subunit biogenesis factor REH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REH1 PE=1 SV=1 172 435 1.0E-28
sp|P38344|REI1_YEAST Cytoplasmic 60S subunit biogenesis factor REI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REI1 PE=1 SV=3 202 433 2.0E-28
sp|Q91VY9|ZN622_MOUSE Zinc finger protein 622 OS=Mus musculus GN=Znf622 PE=1 SV=1 175 405 5.0E-25
sp|Q90Y35|ZN622_CHICK Zinc finger protein 622 OS=Gallus gallus GN=ZNF622 PE=2 SV=1 11 167 2.0E-21
sp|Q7TM96|ZN622_RAT Zinc finger protein 622 OS=Rattus norvegicus GN=Znf622 PE=1 SV=2 202 312 6.0E-21
sp|Q90Y35|ZN622_CHICK Zinc finger protein 622 OS=Gallus gallus GN=ZNF622 PE=2 SV=1 202 301 1.0E-20
sp|Q969S3|ZN622_HUMAN Zinc finger protein 622 OS=Homo sapiens GN=ZNF622 PE=1 SV=1 202 307 1.0E-20
sp|Q91VY9|ZN622_MOUSE Zinc finger protein 622 OS=Mus musculus GN=Znf622 PE=1 SV=1 12 167 5.0E-20
sp|Q7TM96|ZN622_RAT Zinc finger protein 622 OS=Rattus norvegicus GN=Znf622 PE=1 SV=2 11 167 1.0E-19
sp|Q969S3|ZN622_HUMAN Zinc finger protein 622 OS=Homo sapiens GN=ZNF622 PE=1 SV=1 11 137 3.0E-19
sp|Q06709|REH1_YEAST Cytoplasmic 60S subunit biogenesis factor REH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REH1 PE=1 SV=1 11 58 1.0E-12
sp|P38344|REI1_YEAST Cytoplasmic 60S subunit biogenesis factor REI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REI1 PE=1 SV=3 6 54 8.0E-12
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup929
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1995
Ophiocordyceps australis map64 (Brazil) OphauB2|7267
Ophiocordyceps camponoti-floridani Ophcf2|01350
Ophiocordyceps camponoti-rufipedis Ophun1|2366 (this protein)
Ophiocordyceps kimflemingae Ophio5|7595
Ophiocordyceps subramaniannii Hirsu2|6592

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2366
MASADTGSHPYTCNTCQVAYRNIDLQKGHMKSDWHRYNLKRRVASLPPIASTAFTDKVLQARAATTAEADKALFE
RTCEACVKTYYSENAYRNHLLSQKHRQSQAAARHPRDDEVTSVVSSTFSLGEPAADHVGSDAEHEFNQVVESLQK
TTVSQQRPSPVKRPSNPQPVGGDDEDGQGQDASADGSLTVAGSEPSWTPKSCLFCNYSSSTVSLNVSHMERFHGM
FIPEKPYLVDVEGLVVHLQNQVGRHHQCLSCGKIKSTVFAVQTHMRDKSHCTIPFSSEKEQLRIGDFYDFRSTYS
DGDMSDDEPDVKPGGAKLGAKRLTQLIVGPDGQEMDGDGDGDGWETDSSVSSLDSADVTNVPAECHHSRAQRPTH
AVFHDDHELYLPSGRSVGHRSLNRYYRQNLERYPGPEDRVEAIAGEGIVEGAVDKAESNGGDEEPVPRVDGHRQP
VPRASSDRRQLLPRGGVGMAGVSDDKRRLVRKEERRGRDAQRQRERNNEWAYSKRANNQKTYYYRYDGGG*
Coding >Ophun1|2366
ATGGCCTCCGCCGACACCGGCTCGCATCCCTACACTTGCAACACGTGCCAGGTCGCCTACCGTAACATAGACCTG
CAAAAGGGTCACATGAAGAGTGACTGGCACCGGTATAATCTGAAACGTCGCGTCGCCTCGCTGCCTCCCATCGCC
TCGACCGCCTTCACCGACAAAGTTCTCCAGGCCCGCGCCGCCACCACGGCCGAGGCCGACAAGGCTCTCTTTGAG
CGCACCTGCGAAGCCTGCGTCAAGACGTACTACAGCGAGAACGCCTATCGCAACCACCTTCTCAGCCAGAAACAC
AGGCAAAGCCAGGCCGCTGCTCGTCATCCCCGAGACGATGAGGTCACCTCGGTCGTCAGCTCGACCTTCTCCCTC
GGCGAGCCCGCTGCCGATCATGTTGGTAGCGATGCCGAGCACGAGTTTAACCAGGTCGTCGAGAGCCTGCAGAAA
ACTACCGTGTCCCAACAGCGGCCCTCTCCCGTCAAGCGACCTTCGAATCCGCAGCCCGTCGGTGGCGATGACGAA
GATGGCCAAGGCCAAGACGCCTCAGCCGATGGTTCTCTCACCGTGGCGGGCTCCGAGCCCTCGTGGACGCCAAAG
TCGTGTCTTTTCTGCAACTACTCGTCCTCGACGGTGTCTCTCAACGTCAGCCACATGGAGCGCTTCCACGGCATG
TTCATACCCGAGAAGCCATACCTCGTAGACGTCGAGGGCCTCGTTGTGCACCTCCAGAATCAGGTCGGCCGGCAT
CACCAGTGCCTGAGCTGCGGCAAGATCAAGTCGACGGTTTTCGCCGTTCAGACGCACATGCGCGACAAGAGCCAC
TGTACGATACCCTTCTCATCTGAGAAGGAGCAACTCCGAATCGGAGACTTTTACGACTTCCGGAGCACCTACTCG
GACGGCGACATGTCCGATGATGAGCCAGACGTGAAGCCCGGTGGGGCCAAGCTGGGCGCCAAACGGCTCACTCAG
CTGATTGTCGGACCCGACGGCCAAGAGATGGACGGCGACGGCGACGGCGACGGCTGGGAGACGGACAGCTCCGTC
TCGTCTCTCGACTCGGCCGACGTGACGAATGTACCGGCCGAGTGTCACCACTCGCGAGCTCAACGCCCCACGCAC
GCCGTCTTCCACGACGACCATGAGCTCTACCTGCCGTCGGGCAGGTCGGTGGGCCACCGCTCGCTCAACCGCTAC
TATCGACAGAATCTAGAACGGTACCCAGGTCCGGAGGACCGGGTCGAGGCAATCGCGGGCGAGGGCATTGTTGAA
GGTGCCGTTGACAAGGCCGAGTCCAACGGAGGGGACGAAGAACCCGTCCCCAGGGTCGATGGTCACAGGCAGCCC
GTACCCCGGGCCAGCTCGGATCGGCGTCAGCTGCTACCACGCGGCGGTGTTGGCATGGCCGGCGTCTCGGACGAC
AAGAGGCGGCTGGTTCGCAAGGAGGAGCGGCGCGGGCGTGACGCCCAGAGGCAGCGCGAAAGGAACAATGAATGG
GCGTACAGCAAACGGGCCAACAACCAAAAGACCTACTACTACCGCTACGACGGTGGCGGCTAG
Transcript >Ophun1|2366
ATGGCCTCCGCCGACACCGGCTCGCATCCCTACACTTGCAACACGTGCCAGGTCGCCTACCGTAACATAGACCTG
CAAAAGGGTCACATGAAGAGTGACTGGCACCGGTATAATCTGAAACGTCGCGTCGCCTCGCTGCCTCCCATCGCC
TCGACCGCCTTCACCGACAAAGTTCTCCAGGCCCGCGCCGCCACCACGGCCGAGGCCGACAAGGCTCTCTTTGAG
CGCACCTGCGAAGCCTGCGTCAAGACGTACTACAGCGAGAACGCCTATCGCAACCACCTTCTCAGCCAGAAACAC
AGGCAAAGCCAGGCCGCTGCTCGTCATCCCCGAGACGATGAGGTCACCTCGGTCGTCAGCTCGACCTTCTCCCTC
GGCGAGCCCGCTGCCGATCATGTTGGTAGCGATGCCGAGCACGAGTTTAACCAGGTCGTCGAGAGCCTGCAGAAA
ACTACCGTGTCCCAACAGCGGCCCTCTCCCGTCAAGCGACCTTCGAATCCGCAGCCCGTCGGTGGCGATGACGAA
GATGGCCAAGGCCAAGACGCCTCAGCCGATGGTTCTCTCACCGTGGCGGGCTCCGAGCCCTCGTGGACGCCAAAG
TCGTGTCTTTTCTGCAACTACTCGTCCTCGACGGTGTCTCTCAACGTCAGCCACATGGAGCGCTTCCACGGCATG
TTCATACCCGAGAAGCCATACCTCGTAGACGTCGAGGGCCTCGTTGTGCACCTCCAGAATCAGGTCGGCCGGCAT
CACCAGTGCCTGAGCTGCGGCAAGATCAAGTCGACGGTTTTCGCCGTTCAGACGCACATGCGCGACAAGAGCCAC
TGTACGATACCCTTCTCATCTGAGAAGGAGCAACTCCGAATCGGAGACTTTTACGACTTCCGGAGCACCTACTCG
GACGGCGACATGTCCGATGATGAGCCAGACGTGAAGCCCGGTGGGGCCAAGCTGGGCGCCAAACGGCTCACTCAG
CTGATTGTCGGACCCGACGGCCAAGAGATGGACGGCGACGGCGACGGCGACGGCTGGGAGACGGACAGCTCCGTC
TCGTCTCTCGACTCGGCCGACGTGACGAATGTACCGGCCGAGTGTCACCACTCGCGAGCTCAACGCCCCACGCAC
GCCGTCTTCCACGACGACCATGAGCTCTACCTGCCGTCGGGCAGGTCGGTGGGCCACCGCTCGCTCAACCGCTAC
TATCGACAGAATCTAGAACGGTACCCAGGTCCGGAGGACCGGGTCGAGGCAATCGCGGGCGAGGGCATTGTTGAA
GGTGCCGTTGACAAGGCCGAGTCCAACGGAGGGGACGAAGAACCCGTCCCCAGGGTCGATGGTCACAGGCAGCCC
GTACCCCGGGCCAGCTCGGATCGGCGTCAGCTGCTACCACGCGGCGGTGTTGGCATGGCCGGCGTCTCGGACGAC
AAGAGGCGGCTGGTTCGCAAGGAGGAGCGGCGCGGGCGTGACGCCCAGAGGCAGCGCGAAAGGAACAATGAATGG
GCGTACAGCAAACGGGCCAACAACCAAAAGACCTACTACTACCGCTACGACGGTGGCGGCTAG
Gene >Ophun1|2366
ATGGCCTCCGCCGACACCGGCTCGCATCCCTACACTTGCAACACGTGCCAGGTCGCCTACCGTAACATAGACCTG
CAAAAGGGTCACATGAAGAGTGACTGGCAGTGAGTCGTGTCCCGGCTCACCACGCCGTGTTGCTAGCTGCTAACC
ATAGTCCCAGCCGGTATAATCTGAAACGTCGCGTCGCCTCGCTGCCTCCCATCGCCTCGACCGCCTTCACCGACA
AAGTTCTCCAGGCCCGCGCCGCCACCACGGCCGAGGCCGACAAGGCTCTCTTTGAGCGCACCTGCGAAGCCTGCG
TCAAGACGTACTACAGCGAGAACGCCTATCGCAACCACCTTCTCAGCCAGAAACACAGGCAAAGCCAGGCCGCTG
CTCGTCATCCCCGAGACGATGAGGTCACCTCGGTCGTCAGCTCGACCTTCTCCCTCGGCGAGCCCGCTGCCGATC
ATGTTGGTAGCGATGCCGAGCACGAGTTTAACCAGGTCGTCGAGAGCCTGCAGAAAACTACCGTGTCCCAACAGC
GGCCCTCTCCCGTCAAGCGACCTTCGAATCCGCAGCCCGTCGGTGGCGATGACGAAGATGGCCAAGGCCAAGACG
CCTCAGCCGATGGTTCTCTCACCGTGGCGGGCTCCGAGCCCTCGTGGACGCCAAAGTCGTGTCTTTTCTGCAACT
ACTCGTCCTCGACGGTGTCTCTCAACGTCAGCCACATGGAGCGCTTCCACGGCATGTTCATACCCGAGAAGCCAT
ACCTCGTAGACGTCGAGGGCCTCGTTGTGCACCTCCAGAATCAGGTCGGCCGGCATCACCAGTGCCTGAGCTGCG
GCAAGATCAAGTCGACGGTTTTCGCCGTTCAGACGCACATGCGCGACAAGAGCCACTGTACGATACCCTTCTCAT
CTGAGAAGGAGCAACTCCGAATCGGAGACTTTTACGACTTCCGGAGCACCTACTCGGACGGCGACATGTCCGATG
ATGAGCCAGACGTGAAGCCCGGTGGGGCCAAGCTGGGCGCCAAACGGCTCACTCAGCTGATTGTCGGACCCGACG
GCCAAGAGATGGACGGCGACGGCGACGGCGACGGCTGGGAGACGGACAGCTCCGTCTCGTCTCTCGACTCGGCCG
ACGTGACGAATGTACCGGCCGAGTGTCACCACTCGCGAGCTCAACGCCCCACGCACGCCGTCTTCCACGACGACC
ATGAGCTCTACCTGCCGTCGGGCAGGTCGGTGGGCCACCGCTCGCTCAACCGCTACTATCGACAGAATCTAGAAC
GGTACCCAGGTCCGGAGGACCGGGTCGAGGCAATCGCGGGCGAGGGCATTGTTGAAGGTGCCGTTGACAAGGCCG
AGTCCAACGGAGGGGACGAAGAACCCGTCCCCAGGGTCGATGGTCACAGGCAGCCCGTACCCCGGGCCAGCTCGG
ATCGGCGTCAGCTGCTACCACGCGGCGGTGTTGGCATGGCCGGCGTCTCGGACGACAAGAGGCGGCTGGTTCGCA
AGGAGGAGCGGCGCGGGCGTGACGCCCAGAGGCAGCGCGAAAGGAACAATGAATGGGCGTACAGCAAACGGGCCA
ACAACCAAAAGACCTACTACTACCGCTACGACGGTGGCGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail