Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2364
Gene name
LocationContig_216:126..807
Strand+
Gene length (bp)681
Transcript length (bp)681
Coding sequence length (bp)681
Protein length (aa) 227

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily 3.3E-28 38 222

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60066|ALKBH_SCHPO Alpha-ketoglutarate-dependent dioxygenase abh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abh1 PE=2 SV=3 46 224 3.0E-39
sp|Q9SA98|ALKBH_ARATH Alpha-ketoglutarate-dependent dioxygenase alkB OS=Arabidopsis thaliana GN=At1g11780 PE=2 SV=2 46 224 3.0E-23
sp|Q54N08|ALKB_DICDI Alpha-ketoglutarate-dependent dioxygenase alkB OS=Dictyostelium discoideum GN=alkB PE=2 SV=1 46 224 2.0E-22
sp|P0CB42|ALKB1_MOUSE DNA oxidative demethylase ALKBH1 OS=Mus musculus GN=Alkbh1 PE=1 SV=1 36 224 6.0E-15
sp|Q13686|ALKB1_HUMAN DNA oxidative demethylase ALKBH1 OS=Homo sapiens GN=ALKBH1 PE=1 SV=2 36 224 3.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60066|ALKBH_SCHPO Alpha-ketoglutarate-dependent dioxygenase abh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abh1 PE=2 SV=3 46 224 3.0E-39
sp|Q9SA98|ALKBH_ARATH Alpha-ketoglutarate-dependent dioxygenase alkB OS=Arabidopsis thaliana GN=At1g11780 PE=2 SV=2 46 224 3.0E-23
sp|Q54N08|ALKB_DICDI Alpha-ketoglutarate-dependent dioxygenase alkB OS=Dictyostelium discoideum GN=alkB PE=2 SV=1 46 224 2.0E-22
sp|P0CB42|ALKB1_MOUSE DNA oxidative demethylase ALKBH1 OS=Mus musculus GN=Alkbh1 PE=1 SV=1 36 224 6.0E-15
sp|Q13686|ALKB1_HUMAN DNA oxidative demethylase ALKBH1 OS=Homo sapiens GN=ALKBH1 PE=1 SV=2 36 224 3.0E-14
sp|P0CAT7|ALKB_CAUCR Alpha-ketoglutarate-dependent dioxygenase AlkB homolog OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=alkB PE=3 SV=1 46 189 3.0E-07
sp|B8GWW6|ALKB_CAUCN Alpha-ketoglutarate-dependent dioxygenase AlkB homolog OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=alkB PE=3 SV=2 46 189 3.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2364
MHLHYEIPYPEPPPETTVPEGDSRSLFSLPPDAPALFKPKDPTVHKPLSARQVLQRRLHWLTLGGQYDWTNRLYP
PEAPPAFPPDLARFLESLFPDTLAQAAIVNLYSPGDTMMVHRDVSEDVDRGLISLSLGCDALFLIAPDTSDAPAS
GPHEGRPYLLLRLRSGDAIYMTNEARCAWHGVPKVIKGTCPSYLEAWPAQQDGLFDEWRGWMKNKRVNLNVRQMT
D*
Coding >Ophun1|2364
ATGCACCTCCACTACGAAATACCCTACCCCGAGCCCCCCCCCGAGACCACTGTCCCCGAAGGCGACTCCCGCTCC
CTCTTCTCCCTCCCCCCCGACGCGCCAGCCCTCTTCAAGCCCAAGGACCCAACCGTCCACAAGCCCCTCTCCGCC
AGACAAGTCCTGCAGCGCCGCCTCCACTGGCTGACGCTCGGCGGCCAATACGACTGGACAAATCGCCTTTATCCT
CCCGAAGCCCCGCCCGCCTTCCCGCCCGATCTCGCCCGCTTTCTCGAGTCCCTGTTCCCGGATACGCTGGCCCAG
GCGGCCATCGTCAACCTCTACAGCCCCGGAGATACCATGATGGTCCACCGCGACGTCAGTGAGGACGTTGATCGC
GGTCTCATCAGCCTGAGCCTCGGCTGTGACGCCCTCTTTCTCATCGCCCCGGATACATCCGATGCTCCGGCCTCG
GGCCCTCATGAGGGTAGGCCTTATCTGCTCCTGCGCCTTCGCTCCGGTGATGCCATCTACATGACCAACGAGGCC
AGATGCGCCTGGCATGGCGTCCCAAAGGTCATCAAGGGCACCTGCCCAAGCTACCTCGAGGCCTGGCCGGCGCAA
CAGGATGGTCTGTTCGACGAGTGGCGAGGATGGATGAAGAACAAGAGAGTCAATCTCAACGTCAGGCAAATGACC
GACTGA
Transcript >Ophun1|2364
ATGCACCTCCACTACGAAATACCCTACCCCGAGCCCCCCCCCGAGACCACTGTCCCCGAAGGCGACTCCCGCTCC
CTCTTCTCCCTCCCCCCCGACGCGCCAGCCCTCTTCAAGCCCAAGGACCCAACCGTCCACAAGCCCCTCTCCGCC
AGACAAGTCCTGCAGCGCCGCCTCCACTGGCTGACGCTCGGCGGCCAATACGACTGGACAAATCGCCTTTATCCT
CCCGAAGCCCCGCCCGCCTTCCCGCCCGATCTCGCCCGCTTTCTCGAGTCCCTGTTCCCGGATACGCTGGCCCAG
GCGGCCATCGTCAACCTCTACAGCCCCGGAGATACCATGATGGTCCACCGCGACGTCAGTGAGGACGTTGATCGC
GGTCTCATCAGCCTGAGCCTCGGCTGTGACGCCCTCTTTCTCATCGCCCCGGATACATCCGATGCTCCGGCCTCG
GGCCCTCATGAGGGTAGGCCTTATCTGCTCCTGCGCCTTCGCTCCGGTGATGCCATCTACATGACCAACGAGGCC
AGATGCGCCTGGCATGGCGTCCCAAAGGTCATCAAGGGCACCTGCCCAAGCTACCTCGAGGCCTGGCCGGCGCAA
CAGGATGGTCTGTTCGACGAGTGGCGAGGATGGATGAAGAACAAGAGAGTCAATCTCAACGTCAGGCAAATGACC
GACTGA
Gene >Ophun1|2364
ATGCACCTCCACTACGAAATACCCTACCCCGAGCCCCCCCCCGAGACCACTGTCCCCGAAGGCGACTCCCGCTCC
CTCTTCTCCCTCCCCCCCGACGCGCCAGCCCTCTTCAAGCCCAAGGACCCAACCGTCCACAAGCCCCTCTCCGCC
AGACAAGTCCTGCAGCGCCGCCTCCACTGGCTGACGCTCGGCGGCCAATACGACTGGACAAATCGCCTTTATCCT
CCCGAAGCCCCGCCCGCCTTCCCGCCCGATCTCGCCCGCTTTCTCGAGTCCCTGTTCCCGGATACGCTGGCCCAG
GCGGCCATCGTCAACCTCTACAGCCCCGGAGATACCATGATGGTCCACCGCGACGTCAGTGAGGACGTTGATCGC
GGTCTCATCAGCCTGAGCCTCGGCTGTGACGCCCTCTTTCTCATCGCCCCGGATACATCCGATGCTCCGGCCTCG
GGCCCTCATGAGGGTAGGCCTTATCTGCTCCTGCGCCTTCGCTCCGGTGATGCCATCTACATGACCAACGAGGCC
AGATGCGCCTGGCATGGCGTCCCAAAGGTCATCAAGGGCACCTGCCCAAGCTACCTCGAGGCCTGGCCGGCGCAA
CAGGATGGTCTGTTCGACGAGTGGCGAGGATGGATGAAGAACAAGAGAGTCAATCTCAACGTCAGGCAAATGACC
GACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail