Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2359
Gene name
LocationContig_215:12253..15819
Strand-
Gene length (bp)3566
Transcript length (bp)3423
Coding sequence length (bp)3423
Protein length (aa) 1141

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 7.4E-09 542 656
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 4.1E-15 950 1097
PF03733 YccF Inner membrane component domain 4.8E-16 270 323

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P42839|VNX1_YEAST Low affinity vacuolar monovalent cation/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VNX1 PE=1 SV=1 100 748 4.0E-145
sp|Q9P7B3|YI14_SCHPO Putative cation exchanger C521.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.04c PE=1 SV=1 207 779 1.0E-111
sp|Q9P7B3|YI14_SCHPO Putative cation exchanger C521.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.04c PE=1 SV=1 937 1105 2.0E-60
sp|P42839|VNX1_YEAST Low affinity vacuolar monovalent cation/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VNX1 PE=1 SV=1 906 1104 2.0E-55
sp|O34840|CHAA_BACSU Ca(2+)/H(+) antiporter ChaA OS=Bacillus subtilis (strain 168) GN=chaA PE=1 SV=1 943 1102 4.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P42839|VNX1_YEAST Low affinity vacuolar monovalent cation/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VNX1 PE=1 SV=1 100 748 4.0E-145
sp|Q9P7B3|YI14_SCHPO Putative cation exchanger C521.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.04c PE=1 SV=1 207 779 1.0E-111
sp|Q9P7B3|YI14_SCHPO Putative cation exchanger C521.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.04c PE=1 SV=1 937 1105 2.0E-60
sp|P42839|VNX1_YEAST Low affinity vacuolar monovalent cation/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VNX1 PE=1 SV=1 906 1104 2.0E-55
sp|O34840|CHAA_BACSU Ca(2+)/H(+) antiporter ChaA OS=Bacillus subtilis (strain 168) GN=chaA PE=1 SV=1 943 1102 4.0E-18
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 951 1102 5.0E-15
sp|O34840|CHAA_BACSU Ca(2+)/H(+) antiporter ChaA OS=Bacillus subtilis (strain 168) GN=chaA PE=1 SV=1 542 660 7.0E-12
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 544 658 2.0E-11
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 948 1102 9.0E-11
sp|Q9LFZ8|CAX6_ARATH Putative vacuolar cation/proton exchanger 6 OS=Arabidopsis thaliana GN=CAX6 PE=3 SV=3 540 664 5.0E-10
sp|P74072|CAX_SYNY3 Ca(2+)/H(+) antiporter OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1336 PE=1 SV=1 951 1102 1.0E-09
sp|P74072|CAX_SYNY3 Ca(2+)/H(+) antiporter OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1336 PE=1 SV=1 544 668 1.0E-08
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 544 661 2.0E-08
sp|Q945S5|CAX4_ARATH Vacuolar cation/proton exchanger 4 OS=Arabidopsis thaliana GN=CAX4 PE=1 SV=2 952 1103 3.0E-08
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 966 1101 5.0E-08
sp|Q5KQN0|CAX2_ORYSJ Vacuolar cation/proton exchanger 2 OS=Oryza sativa subsp. japonica GN=CAX2 PE=2 SV=2 956 1101 6.0E-08
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 540 664 1.0E-07
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 966 1101 1.0E-07
sp|Q93Z81|CAX3_ARATH Vacuolar cation/proton exchanger 3 OS=Arabidopsis thaliana GN=CAX3 PE=1 SV=1 952 1101 1.0E-07
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 538 664 2.0E-07
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 947 1102 4.0E-07
sp|Q6K1C4|CAX3_ORYSJ Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2 543 667 6.0E-07
sp|Q5KTQ9|CAX1C_ORYSJ Vacuolar cation/proton exchanger 1c OS=Oryza sativa subsp. japonica GN=CAX1c PE=2 SV=1 939 1101 1.0E-06
sp|Q9LFZ8|CAX6_ARATH Putative vacuolar cation/proton exchanger 6 OS=Arabidopsis thaliana GN=CAX6 PE=3 SV=3 966 1101 2.0E-06
sp|Q5KQN0|CAX2_ORYSJ Vacuolar cation/proton exchanger 2 OS=Oryza sativa subsp. japonica GN=CAX2 PE=2 SV=2 536 668 2.0E-06
sp|Q5TKG3|CAX1B_ORYSJ Vacuolar cation/proton exchanger 1b OS=Oryza sativa subsp. japonica GN=CAX1b PE=2 SV=1 543 652 2.0E-06
sp|Q6K1C4|CAX3_ORYSJ Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2 956 1101 3.0E-06
sp|Q945S5|CAX4_ARATH Vacuolar cation/proton exchanger 4 OS=Arabidopsis thaliana GN=CAX4 PE=1 SV=2 542 652 4.0E-06
sp|Q39253|CAX1_ARATH Vacuolar cation/proton exchanger 1 OS=Arabidopsis thaliana GN=CAX1 PE=1 SV=3 952 1101 5.0E-06
sp|Q769E5|CAX1A_ORYSJ Vacuolar cation/proton exchanger 1a OS=Oryza sativa subsp. japonica GN=CAX1a PE=1 SV=1 939 1101 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 278 300 22
2 415 437 22
3 441 458 17
4 509 528 19
5 538 560 22
6 573 595 22
7 605 627 22
8 639 661 22
9 710 732 22
10 949 968 19
11 983 1005 22
12 1018 1040 22
13 1055 1077 22
14 1084 1106 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2359
MDRDHPRRPASPPSDPASPTDARPPPELRVELPDEGGLSESLQSGDTVRRRVTEGIGYVASSSRPPPIDASQDRL
QPRSAASTPRPSNISAPDRLKSFSRQRKPILPRRISSNTPHRGEVFSADDDTHEVEADAVSRQRDLPSGYGTRRR
TQMSSTLRLPSYRAAEAEPEAEPNRGVPPTTTEEDEDGESPDQEQELPLEEHVDCDSSSDLSDAESFTLKDRQQA
INQTHPFGIRVWKPALYKKDRSIQKTAQADIHSTPGGHVSRWLLLFNLVWTLCFGWWMAVLAAFGAVVCLLFAAA
PSGREYGRILWGLAGYLFYPFGKFVRLEKDEAYLHEDAHEGRSVSEYEQWQSGDLEYGRLFFGPDRSRSIVGRSR
RSLDSEPSETESLLGRGRRGESRSANVTGRRQRLFGRGEWNIGRVIFFIFFWCLISPSLIVVSAICWFLVFWIPM
GKVTILLFDHLRRHPLALSFESHVRYTRAEDAPDSSILLCTYRAVGSKYWKYTVDGTNIFLINLMAVVCFVIFDW
LVLDRTLHLDNHITSPAFLFTASLLSIIPLAYFIGQAVASISAQSSMGLGAAVNAFFATVVEVFLYCVALGQGKG
QLVEGSIIGSIFAGVLFLPGISMCFGAIKRKTQRFNAKSAGVTSTMLLFAAVGAFSPTLFYQIHGTHELNCLDCD
DLNPDGRHGSKRTEDCRRCFFSQLPALDNRFYLEAVRPYCYLAAAMLFLSYLIGLWFTLRTHAAVIWNAEVEEKR
HDEHLQASVLKSAQPHPAVETTGADIRDSQLYKRILGQSLRQAGLPSTSDDGQRRSSAVSQEAAKAAAASVNGSA
AAAATTTTTPHVVPPRGNESGRPAVHVPGLSAAENTALAREVAEIAATAATIASRERFTRRLSTIPTGSTVGSRG
HAPAPRAVVVHEVGVEDPAAAAAAAETATAHGGGHGGHDAPNWGRTKSSVILLGATVLYAVIAEILVDTVDVVLE
SFSIDQKFLGITLFALVPNTTEFLNAISFAMNGNIALSMEIGSAYALQVCLLQIPCLVLFSALYPSTAPGEDAMM
YSFSLLFPQWDMVTVILCVFLLSNVYGEGKSNYFKGSILLLTYLVVITGYFFSGYTTDVMGSARMDVMTDGRLQS
FKTIGRMGRGEAFPV*
Coding >Ophun1|2359
ATGGATCGAGACCACCCTCGCCGTCCGGCGTCGCCACCTTCCGACCCGGCGTCGCCTACCGATGCCCGTCCTCCG
CCCGAGCTGAGGGTCGAGCTCCCCGATGAAGGAGGCCTCTCGGAGAGCCTGCAGTCGGGCGATACCGTGAGGCGT
CGCGTCACCGAAGGCATTGGATATGTGGCCAGCTCTAGTCGGCCTCCGCCCATCGACGCGTCGCAGGATCGCCTT
CAGCCCAGGAGCGCTGCCTCGACGCCGCGTCCGAGCAATATCTCGGCGCCTGATCGCCTCAAGTCCTTCTCCCGT
CAGCGGAAACCCATCTTGCCGCGTCGCATATCCTCCAACACGCCGCACCGGGGCGAAGTCTTCTCCGCCGACGAT
GACACCCACGAGGTCGAGGCCGATGCCGTCAGCCGCCAGCGAGATCTTCCCTCCGGTTACGGCACCCGCCGTCGC
ACCCAGATGTCGTCGACCCTTCGCCTTCCATCGTATCGCGCCGCCGAAGCCGAGCCCGAAGCCGAGCCGAACCGC
GGCGTGCCACCCACGACGACGGAGGAGGACGAGGACGGAGAGAGCCCCGATCAGGAACAGGAGTTGCCGCTCGAG
GAGCATGTCGACTGCGACTCTAGCAGTGACCTGAGCGACGCCGAGAGCTTCACCCTCAAGGACCGACAGCAGGCC
ATCAACCAGACGCATCCCTTTGGCATCCGCGTCTGGAAGCCCGCCCTTTACAAAAAGGATCGGTCGATCCAGAAG
ACGGCTCAGGCCGACATCCACTCCACCCCTGGCGGTCACGTCAGTCGCTGGCTGCTGCTCTTCAACCTCGTCTGG
ACCTTGTGCTTCGGCTGGTGGATGGCCGTGCTGGCCGCCTTTGGTGCCGTCGTCTGTCTCCTTTTCGCCGCCGCT
CCGAGCGGTAGGGAGTACGGCCGCATCCTCTGGGGCCTGGCCGGCTACCTCTTCTACCCATTTGGCAAGTTTGTG
CGGCTGGAAAAGGATGAGGCCTACCTGCACGAGGACGCGCACGAGGGCCGGAGCGTGTCCGAGTACGAGCAATGG
CAGAGCGGCGACCTCGAGTACGGCCGGCTCTTCTTTGGGCCCGACCGCAGCCGCTCCATCGTCGGCCGCTCCCGC
CGGAGCCTCGATTCGGAGCCGAGCGAGACGGAGAGCCTGCTGGGCCGCGGCCGACGAGGCGAGTCCCGCTCGGCC
AACGTCACAGGTCGACGCCAGAGGCTCTTTGGCCGGGGCGAGTGGAACATTGGCCGCGTCATCTTCTTCATCTTC
TTCTGGTGCCTCATCTCGCCCTCGCTCATCGTCGTTTCCGCCATCTGCTGGTTCCTCGTCTTCTGGATCCCCATG
GGCAAGGTCACCATCCTCCTCTTCGACCACCTGAGGCGCCACCCGCTTGCGCTGTCGTTTGAGTCGCATGTCCGC
TACACGCGCGCCGAGGACGCGCCCGACTCGTCCATCCTGCTCTGCACCTATCGCGCCGTCGGCTCCAAGTACTGG
AAGTACACGGTGGACGGCACCAACATCTTCCTCATCAACCTCATGGCCGTCGTCTGCTTCGTCATCTTCGATTGG
CTCGTCCTCGACCGCACCCTGCACCTCGACAACCACATCACCTCACCGGCCTTTCTCTTCACCGCTTCTCTGCTG
TCCATCATACCCCTGGCCTACTTCATCGGGCAGGCCGTGGCCTCCATCTCGGCCCAGTCGTCGATGGGCCTGGGC
GCCGCCGTCAATGCCTTTTTCGCCACCGTCGTCGAGGTCTTTCTGTACTGCGTGGCCCTCGGTCAGGGCAAGGGC
CAACTCGTCGAGGGGAGCATCATCGGCAGCATCTTCGCCGGCGTGCTCTTCCTGCCCGGCATTTCCATGTGCTTC
GGCGCCATTAAGCGCAAGACGCAGCGCTTCAACGCCAAGTCGGCCGGCGTCACGTCGACCATGCTGCTGTTCGCC
GCCGTCGGCGCCTTTAGTCCGACGCTCTTCTACCAGATCCACGGCACGCACGAGCTCAACTGCCTCGACTGTGAT
GACTTGAACCCGGACGGCCGCCACGGCTCGAAGCGAACCGAAGACTGCCGGCGTTGCTTCTTCTCGCAGCTGCCG
GCGCTGGACAACCGGTTTTACCTCGAGGCCGTGCGGCCCTACTGCTACCTGGCGGCGGCCATGCTGTTCCTGTCG
TACCTGATTGGGCTGTGGTTCACGCTGCGGACGCACGCCGCCGTCATCTGGAACGCCGAGGTCGAGGAGAAGAGG
CACGACGAGCACCTGCAGGCGTCTGTGCTTAAGAGCGCGCAGCCGCATCCGGCCGTCGAGACGACGGGTGCCGAC
ATCCGCGACTCGCAGCTGTACAAGCGCATCCTGGGCCAGTCGCTCAGGCAGGCCGGTCTGCCGTCAACGTCTGAC
GACGGGCAGCGACGGTCGTCGGCCGTGTCCCAGGAAGCTGCCAAGGCGGCGGCAGCGTCGGTCAACGGATCGGCT
GCGGCTGCGGCGACGACGACGACGACGCCACACGTGGTTCCTCCCCGGGGCAACGAGTCCGGCCGGCCGGCGGTG
CACGTGCCGGGCCTCAGCGCGGCGGAGAACACGGCCCTGGCGCGCGAGGTGGCAGAGATTGCGGCGACGGCGGCA
ACGATAGCGTCGCGCGAGCGCTTCACGCGTAGGCTGTCGACGATTCCCACCGGATCGACGGTCGGGTCACGCGGT
CACGCGCCGGCGCCGCGGGCCGTAGTCGTTCACGAAGTCGGTGTCGAGGATCCGGCTGCGGCTGCGGCGGCTGCG
GAGACGGCGACGGCCCACGGCGGAGGCCACGGCGGTCACGACGCGCCCAACTGGGGGCGGACCAAGAGCTCCGTC
ATCCTCCTCGGGGCCACGGTGCTATACGCCGTCATCGCCGAGATCCTGGTGGACACGGTCGACGTCGTGCTGGAG
AGCTTCTCCATCGACCAAAAGTTTCTCGGCATCACGCTGTTTGCCCTGGTGCCCAACACGACGGAATTCCTGAAT
GCCATCTCGTTCGCCATGAACGGCAATATCGCGCTCTCGATGGAAATCGGGTCGGCCTACGCACTCCAGGTGTGC
CTGCTGCAGATTCCATGCCTGGTGCTCTTTTCGGCGCTGTATCCGAGCACGGCGCCAGGCGAGGACGCCATGATG
TACTCGTTCTCGTTGCTGTTCCCGCAGTGGGACATGGTGACGGTCATCCTCTGCGTCTTTTTGCTGAGCAACGTG
TACGGCGAAGGCAAAAGCAACTACTTCAAGGGCAGCATCCTGCTGCTGACGTATCTGGTGGTCATCACGGGCTAC
TTCTTCAGCGGCTACACGACGGACGTGATGGGTTCGGCGAGGATGGACGTGATGACGGATGGGCGTTTGCAGTCG
TTTAAGACGATCGGGAGGATGGGAAGAGGAGAGGCCTTTCCCGTGTGA
Transcript >Ophun1|2359
ATGGATCGAGACCACCCTCGCCGTCCGGCGTCGCCACCTTCCGACCCGGCGTCGCCTACCGATGCCCGTCCTCCG
CCCGAGCTGAGGGTCGAGCTCCCCGATGAAGGAGGCCTCTCGGAGAGCCTGCAGTCGGGCGATACCGTGAGGCGT
CGCGTCACCGAAGGCATTGGATATGTGGCCAGCTCTAGTCGGCCTCCGCCCATCGACGCGTCGCAGGATCGCCTT
CAGCCCAGGAGCGCTGCCTCGACGCCGCGTCCGAGCAATATCTCGGCGCCTGATCGCCTCAAGTCCTTCTCCCGT
CAGCGGAAACCCATCTTGCCGCGTCGCATATCCTCCAACACGCCGCACCGGGGCGAAGTCTTCTCCGCCGACGAT
GACACCCACGAGGTCGAGGCCGATGCCGTCAGCCGCCAGCGAGATCTTCCCTCCGGTTACGGCACCCGCCGTCGC
ACCCAGATGTCGTCGACCCTTCGCCTTCCATCGTATCGCGCCGCCGAAGCCGAGCCCGAAGCCGAGCCGAACCGC
GGCGTGCCACCCACGACGACGGAGGAGGACGAGGACGGAGAGAGCCCCGATCAGGAACAGGAGTTGCCGCTCGAG
GAGCATGTCGACTGCGACTCTAGCAGTGACCTGAGCGACGCCGAGAGCTTCACCCTCAAGGACCGACAGCAGGCC
ATCAACCAGACGCATCCCTTTGGCATCCGCGTCTGGAAGCCCGCCCTTTACAAAAAGGATCGGTCGATCCAGAAG
ACGGCTCAGGCCGACATCCACTCCACCCCTGGCGGTCACGTCAGTCGCTGGCTGCTGCTCTTCAACCTCGTCTGG
ACCTTGTGCTTCGGCTGGTGGATGGCCGTGCTGGCCGCCTTTGGTGCCGTCGTCTGTCTCCTTTTCGCCGCCGCT
CCGAGCGGTAGGGAGTACGGCCGCATCCTCTGGGGCCTGGCCGGCTACCTCTTCTACCCATTTGGCAAGTTTGTG
CGGCTGGAAAAGGATGAGGCCTACCTGCACGAGGACGCGCACGAGGGCCGGAGCGTGTCCGAGTACGAGCAATGG
CAGAGCGGCGACCTCGAGTACGGCCGGCTCTTCTTTGGGCCCGACCGCAGCCGCTCCATCGTCGGCCGCTCCCGC
CGGAGCCTCGATTCGGAGCCGAGCGAGACGGAGAGCCTGCTGGGCCGCGGCCGACGAGGCGAGTCCCGCTCGGCC
AACGTCACAGGTCGACGCCAGAGGCTCTTTGGCCGGGGCGAGTGGAACATTGGCCGCGTCATCTTCTTCATCTTC
TTCTGGTGCCTCATCTCGCCCTCGCTCATCGTCGTTTCCGCCATCTGCTGGTTCCTCGTCTTCTGGATCCCCATG
GGCAAGGTCACCATCCTCCTCTTCGACCACCTGAGGCGCCACCCGCTTGCGCTGTCGTTTGAGTCGCATGTCCGC
TACACGCGCGCCGAGGACGCGCCCGACTCGTCCATCCTGCTCTGCACCTATCGCGCCGTCGGCTCCAAGTACTGG
AAGTACACGGTGGACGGCACCAACATCTTCCTCATCAACCTCATGGCCGTCGTCTGCTTCGTCATCTTCGATTGG
CTCGTCCTCGACCGCACCCTGCACCTCGACAACCACATCACCTCACCGGCCTTTCTCTTCACCGCTTCTCTGCTG
TCCATCATACCCCTGGCCTACTTCATCGGGCAGGCCGTGGCCTCCATCTCGGCCCAGTCGTCGATGGGCCTGGGC
GCCGCCGTCAATGCCTTTTTCGCCACCGTCGTCGAGGTCTTTCTGTACTGCGTGGCCCTCGGTCAGGGCAAGGGC
CAACTCGTCGAGGGGAGCATCATCGGCAGCATCTTCGCCGGCGTGCTCTTCCTGCCCGGCATTTCCATGTGCTTC
GGCGCCATTAAGCGCAAGACGCAGCGCTTCAACGCCAAGTCGGCCGGCGTCACGTCGACCATGCTGCTGTTCGCC
GCCGTCGGCGCCTTTAGTCCGACGCTCTTCTACCAGATCCACGGCACGCACGAGCTCAACTGCCTCGACTGTGAT
GACTTGAACCCGGACGGCCGCCACGGCTCGAAGCGAACCGAAGACTGCCGGCGTTGCTTCTTCTCGCAGCTGCCG
GCGCTGGACAACCGGTTTTACCTCGAGGCCGTGCGGCCCTACTGCTACCTGGCGGCGGCCATGCTGTTCCTGTCG
TACCTGATTGGGCTGTGGTTCACGCTGCGGACGCACGCCGCCGTCATCTGGAACGCCGAGGTCGAGGAGAAGAGG
CACGACGAGCACCTGCAGGCGTCTGTGCTTAAGAGCGCGCAGCCGCATCCGGCCGTCGAGACGACGGGTGCCGAC
ATCCGCGACTCGCAGCTGTACAAGCGCATCCTGGGCCAGTCGCTCAGGCAGGCCGGTCTGCCGTCAACGTCTGAC
GACGGGCAGCGACGGTCGTCGGCCGTGTCCCAGGAAGCTGCCAAGGCGGCGGCAGCGTCGGTCAACGGATCGGCT
GCGGCTGCGGCGACGACGACGACGACGCCACACGTGGTTCCTCCCCGGGGCAACGAGTCCGGCCGGCCGGCGGTG
CACGTGCCGGGCCTCAGCGCGGCGGAGAACACGGCCCTGGCGCGCGAGGTGGCAGAGATTGCGGCGACGGCGGCA
ACGATAGCGTCGCGCGAGCGCTTCACGCGTAGGCTGTCGACGATTCCCACCGGATCGACGGTCGGGTCACGCGGT
CACGCGCCGGCGCCGCGGGCCGTAGTCGTTCACGAAGTCGGTGTCGAGGATCCGGCTGCGGCTGCGGCGGCTGCG
GAGACGGCGACGGCCCACGGCGGAGGCCACGGCGGTCACGACGCGCCCAACTGGGGGCGGACCAAGAGCTCCGTC
ATCCTCCTCGGGGCCACGGTGCTATACGCCGTCATCGCCGAGATCCTGGTGGACACGGTCGACGTCGTGCTGGAG
AGCTTCTCCATCGACCAAAAGTTTCTCGGCATCACGCTGTTTGCCCTGGTGCCCAACACGACGGAATTCCTGAAT
GCCATCTCGTTCGCCATGAACGGCAATATCGCGCTCTCGATGGAAATCGGGTCGGCCTACGCACTCCAGGTGTGC
CTGCTGCAGATTCCATGCCTGGTGCTCTTTTCGGCGCTGTATCCGAGCACGGCGCCAGGCGAGGACGCCATGATG
TACTCGTTCTCGTTGCTGTTCCCGCAGTGGGACATGGTGACGGTCATCCTCTGCGTCTTTTTGCTGAGCAACGTG
TACGGCGAAGGCAAAAGCAACTACTTCAAGGGCAGCATCCTGCTGCTGACGTATCTGGTGGTCATCACGGGCTAC
TTCTTCAGCGGCTACACGACGGACGTGATGGGTTCGGCGAGGATGGACGTGATGACGGATGGGCGTTTGCAGTCG
TTTAAGACGATCGGGAGGATGGGAAGAGGAGAGGCCTTTCCCGTGTGA
Gene >Ophun1|2359
ATGGATCGAGACCACCCTCGCCGTCCGGCGTCGCCACCTTCCGACCCGGCGTCGCCTACCGATGCCCGTCCTCCG
CCCGAGCTGAGGGTCGAGCTCCCCGATGAAGGAGGCCTCTCGGAGAGCCTGCAGTCGGGCGATACCGTGAGGCGT
CGCGTCACCGAAGGCATTGGATATGGTCAGTCTGTTGTCGTTGACGCCGAGGGGCACGCGGGGAACTCACAATCG
CGCTCTCGACTCTCAGGTTCCATACTTTCGCCAGTGGCCAGCTCTAGTCGGCCTCCGCCCATCGACGCGTCGCAG
GATCGCCTTCAGCCCAGGAGCGCTGCCTCGACGCCGCGTCCGAGCAATATCTCGGCGCCTGATCGCCTCAAGTCC
TTCTCCCGTCAGCGGAAACCCATCTTGCCGCGTCGCATATCCTCCAACACGCCGCACCGGGGCGAAGTCTTCTCC
GCCGACGATGACACCCACGAGGTCGAGGCCGATGCCGTCAGCCGCCAGCGAGATCTTCCCTCCGGTTACGGCACC
CGCCGTCGCACCCAGATGTCGTCGACCCTTCGCCTTCCATCGTATCGCGCCGCCGAAGCCGAGCCCGAAGCCGAG
CCGAACCGCGGCGTGCCACCCACGACGACGGAGGAGGACGAGGACGGAGAGAGCCCCGATCAGGAACAGGAGTTG
CCGCTCGAGGAGCATGTCGACTGCGACTCTAGCAGTGACCTGAGCGACGCCGAGAGCTTCACCCTCAAGGACCGA
CAGCAGGCCATCAACCAGACGCATCCCTTTGGCATCCGCGTCTGGAAGCCCGCCCTTTACAAAAAGGATCGGTCG
ATCCAGAAGACGGCTCAGGCCGACATCCACTCCACCCCTGGCGGTCACGTCAGTCGCTGGCTGCTGCTCTTCAAC
CTCGTCTGGACCTTGTGCTTCGGCTGGTGGATGGCCGTGCTGGCCGCCTTTGGTGCCGTCGTCTGTCTCCTTTTC
GCCGCCGCTCCGAGCGGTAGGGAGTACGGCCGCATCCTCTGGGGCCTGGCCGGCTACCTCTTCTACCCATTTGGC
AAGTTTGTGCGGCTGGAAAAGGATGAGGCCTACCTGCACGAGGACGCGCACGAGGGCCGGAGCGTGTCCGAGTAC
GAGCAATGGCAGAGCGGCGACCTCGAGTACGGCCGGCTCTTCTTTGGGCCCGACCGCAGCCGCTCCATCGTCGGC
CGCTCCCGCCGGAGCCTCGATTCGGAGCCGAGCGAGACGGAGAGCCTGCTGGGCCGCGGCCGACGAGGCGAGTCC
CGCTCGGCCAACGTCACAGGTCGACGCCAGAGGCTCTTTGGCCGGGGCGAGTGGAACATTGGCCGCGTCATCTTC
TTCATCTTCTTCTGGTGCCTCATCTCGCCCTCGCTCATCGTCGTTTCCGCCATCTGCTGGTTCCTCGTCTTCTGG
ATCCCCATGGGCAAGGTCACCATCCTCCTCTTCGACCACCTGAGGCGCCACCCGCTTGCGCTGTCGTTTGAGTCG
CATGTCCGCTACACGCGCGCCGAGGACGCGCCCGACTCGTCCATCCTGCTCTGCACCTATCGCGCCGTCGGCTCC
AAGTACTGGAAGTACACGGTGGACGGCACCAACATCTTCCTCATCAACCTCATGGCCGTCGTCTGCTTCGTCATC
TTCGATTGGCTCGTCCTCGACCGCACCCTGCACCTCGACAACCACATCACCTCACCGGCCTTTCTCTTCACCGCT
TCTCTGCTGTCCATCATACCCCTGGCCTACTTCATCGGGCAGGCCGTGGCCTCCATCTCGGCCCAGTCGTCGATG
GGCCTGGGCGCCGCCGTCAATGCCTTTTTCGCCACCGTCGTCGAGGTCTTTCTGTACTGCGTGGCCCTCGGTCAG
GGCAAGGGCCAACTCGTCGAGGGGAGCATCATCGGCAGCATCTTCGCCGGCGTGCTCTTCCTGCCCGGCATTTCC
ATGTGCTTCGGCGCCATTAAGCGCAAGACGCAGCGCTTCAACGCCAAGTCGGCCGGCGTCACGTCGACCATGCTG
CTGTTCGCCGCCGTCGGCGCCTTTAGTCCGACGCTCTTCTACCAGATCCACGGCACGCACGAGCTCAACTGCCTC
GACTGTGATGACTTGAACCCGGACGGCCGCCACGGCTCGAAGCGAACCGAAGACTGCCGGCGTTGCTTCTTCTCG
CAGCTGCCGGCGCTGGACAACCGGTTTTACCTCGAGGCCGTGCGGCCCTACTGCTACCTGGCGGCGGCCATGCTG
TTCCTGTCGTACCTGATTGGGCTGTGGTTCACGCTGCGGACGCACGCCGCCGTCATCTGGAACGCCGAGGTCGAG
GAGAAGAGGCACGACGAGCACCTGCAGGCGTCTGTGCTTAAGAGCGCGCAGCCGCATCCGGCCGTCGAGACGACG
GGTGCCGACATCCGCGACTCGCAGCTGTACAAGCGCATCCTGGGCCAGTCGCTCAGGCAGGCCGGTCTGCCGTCA
ACGTCTGACGACGGGCAGCGACGGTCGTCGGCCGTGTCCCAGGAAGCTGCCAAGGCGGCGGCAGCGTCGGTCAAC
GGATCGGCTGCGGCTGCGGCGACGACGACGACGACGCCACACGTGGTTCCTCCCCGGGGCAACGAGTCCGGCCGG
CCGGCGGTGCACGTGCCGGGCCTCAGCGCGGCGGAGAACACGGCCCTGGCGCGCGAGGTGGCAGAGATTGCGGCG
ACGGCGGCAACGATAGCGTCGCGCGAGCGCTTCACGCGTAGGCTGTCGACGATTCCCACCGGATCGACGGTCGGG
TCACGCGGTCACGCGCCGGCGCCGCGGGCCGTAGTCGTTCACGAAGTCGGTGTCGAGGATCCGGCTGCGGCTGCG
GCGGCTGCGGAGACGGCGACGGCCCACGGCGGAGGCCACGGCGGTCACGACGCGCCCAACTGGGGGCGGACCAAG
AGCTCCGTCATCCTCCTCGGGGCCACGGTGCTATACGCCGTCATCGCCGAGATCCTGGTGGACACGGTCGACGTC
GTGCTGGAGAGCTTCTCCATCGACCAAAAGTTTCTCGGCATCACGCTGTTTGCCCTGGTGCCCAACACGACGGAA
TTCCTGGTAAGTAGGCTGCGGCCATGGACGGTCGCAGGTTCGAGCTGACGGTCTCATGTTTGCAGAATGCCATCT
CGTTCGCCATGAACGGCAATATCGCGCTCTCGATGGAAATCGGGTCGGCCTACGCACTCCAGGTGTGCCTGCTGC
AGATTCCATGCCTGGTGCTCTTTTCGGCGCTGTATCCGAGCACGGCGCCAGGCGAGGACGCCATGATGTACTCGT
TCTCGTTGCTGTTCCCGCAGTGGGACATGGTGACGGTCATCCTCTGCGTCTTTTTGCTGAGCAACGTGTACGGCG
AAGGCAAAAGCAACTACTTCAAGGGCAGCATCCTGCTGCTGACGTATCTGGTGGTCATCACGGGCTACTTCTTCA
GCGGCTACACGACGGACGTGATGGGTTCGGCGAGGATGGACGTGATGACGGATGGGCGTTTGCAGTCGTTTAAGA
CGATCGGGAGGATGGGAAGAGGAGAGGCCTTTCCCGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail