Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2358
Gene name
LocationContig_215:9463..10888
Strand-
Gene length (bp)1425
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20150 2EXR 2EXR family 1.6E-07 15 137

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2227
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1829
Ophiocordyceps australis map64 (Brazil) OphauB2|1529
Ophiocordyceps camponoti-floridani Ophcf2|03690
Ophiocordyceps camponoti-rufipedis Ophun1|2358 (this protein)
Ophiocordyceps kimflemingae Ophio5|3180
Ophiocordyceps subramaniannii Hirsu2|2847

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2358
MASIRFDVPDGCRVFTLFPRLPAELRHRIWEAYLCDPGVNFIKLQVWDLHSGAWGRPMVRSPAAEAAAAAADGSA
AEELDDVGRLLLRHDCLPRVSIFSRLVSSYPKNPLADHSQHRELRARLAAMAATCVESHSLVRSLMARPGVLRLE
SGLFVSLSRSPDVTLLEYYPHELYKGSGTLNVDIFCPTLDLIRRLAVRYCHVWRPEVKESWSGGKPCLEDPGNCP
THLYQFLARHLPSLREFYFVDYFIVPKTAEERGDAMSVDGDEDDDDDVDDATRRRRSGINPVFSVRHRRFHDVSD
CDPDTCDWKLNRKSLKILDWLRDHFVRYASQSHTSRHKTPEKVYFGLLACEYVIPTPSHRRDPPKTRVRPPSDRR
RGTPGGRIEAGRAALARASQSTPRSISSSTSAASRPLSRMSGGLVTEPAATSMYVFGSGRGDDFRFTFSQPYGGG
SRWLEA*
Coding >Ophun1|2358
ATGGCTAGCATCAGGTTCGACGTGCCCGACGGCTGCCGCGTCTTCACGCTCTTTCCGCGGCTCCCCGCTGAACTG
CGCCACCGCATCTGGGAAGCCTATCTGTGCGACCCGGGCGTCAACTTCATCAAGCTTCAGGTCTGGGACCTCCAT
AGCGGTGCCTGGGGCAGACCCATGGTGCGCTCCCCCGCCGCAGAGGCCGCGGCTGCGGCAGCTGATGGCTCGGCT
GCCGAGGAACTGGACGACGTGGGCCGACTGCTTTTGCGCCACGACTGTCTCCCGCGGGTTTCCATCTTCTCTCGC
CTCGTTTCGAGTTACCCCAAAAACCCGTTGGCCGACCACTCGCAGCACCGCGAGTTGCGTGCCCGGCTGGCCGCC
ATGGCTGCAACCTGCGTCGAGTCCCACAGCCTTGTCCGCAGCCTGATGGCGAGGCCGGGCGTTTTGCGGCTTGAG
TCGGGTCTCTTTGTCTCCCTCAGCCGCTCTCCGGACGTGACGCTCCTGGAATATTACCCTCACGAGCTTTACAAG
GGGTCCGGTACTCTGAATGTCGACATCTTTTGCCCGACCCTCGACCTGATTCGCCGCCTCGCCGTTCGCTATTGT
CACGTATGGAGGCCCGAGGTGAAGGAATCCTGGTCCGGAGGCAAGCCCTGCCTCGAGGATCCCGGCAACTGCCCA
ACTCATCTATATCAGTTCCTCGCCAGGCATCTACCCAGCCTTCGCGAGTTTTACTTTGTCGACTACTTTATCGTG
CCCAAGACGGCCGAGGAAAGGGGTGACGCCATGTCTGTCGATGGTGACGAAGACGACGACGACGACGTCGACGAC
GCCACCCGCCGTCGCCGTTCAGGCATCAATCCCGTCTTTAGTGTCCGCCATCGGCGCTTTCACGACGTCAGCGAC
TGCGACCCGGACACGTGCGACTGGAAGTTGAACCGCAAGTCGCTCAAGATCTTGGACTGGCTTCGCGACCATTTC
GTACGGTACGCGTCTCAGAGCCACACCAGCCGCCACAAGACGCCCGAGAAGGTCTACTTTGGCCTCCTCGCCTGC
GAGTATGTCATTCCCACGCCCTCCCACCGACGCGACCCGCCCAAGACCCGAGTTAGACCGCCGAGTGACCGCCGA
CGGGGCACGCCCGGGGGGAGGATCGAAGCGGGACGGGCGGCACTCGCTCGTGCTTCACAATCAACTCCTCGGAGC
ATCTCTTCTTCTACTTCTGCTGCTTCCAGGCCTTTGAGCCGAATGAGCGGGGGATTGGTGACGGAGCCGGCCGCG
ACCTCAATGTACGTCTTTGGATCCGGCCGGGGGGACGACTTTCGATTTACGTTTTCACAGCCTTACGGGGGGGGT
TCGAGGTGGCTTGAGGCGTAG
Transcript >Ophun1|2358
ATGGCTAGCATCAGGTTCGACGTGCCCGACGGCTGCCGCGTCTTCACGCTCTTTCCGCGGCTCCCCGCTGAACTG
CGCCACCGCATCTGGGAAGCCTATCTGTGCGACCCGGGCGTCAACTTCATCAAGCTTCAGGTCTGGGACCTCCAT
AGCGGTGCCTGGGGCAGACCCATGGTGCGCTCCCCCGCCGCAGAGGCCGCGGCTGCGGCAGCTGATGGCTCGGCT
GCCGAGGAACTGGACGACGTGGGCCGACTGCTTTTGCGCCACGACTGTCTCCCGCGGGTTTCCATCTTCTCTCGC
CTCGTTTCGAGTTACCCCAAAAACCCGTTGGCCGACCACTCGCAGCACCGCGAGTTGCGTGCCCGGCTGGCCGCC
ATGGCTGCAACCTGCGTCGAGTCCCACAGCCTTGTCCGCAGCCTGATGGCGAGGCCGGGCGTTTTGCGGCTTGAG
TCGGGTCTCTTTGTCTCCCTCAGCCGCTCTCCGGACGTGACGCTCCTGGAATATTACCCTCACGAGCTTTACAAG
GGGTCCGGTACTCTGAATGTCGACATCTTTTGCCCGACCCTCGACCTGATTCGCCGCCTCGCCGTTCGCTATTGT
CACGTATGGAGGCCCGAGGTGAAGGAATCCTGGTCCGGAGGCAAGCCCTGCCTCGAGGATCCCGGCAACTGCCCA
ACTCATCTATATCAGTTCCTCGCCAGGCATCTACCCAGCCTTCGCGAGTTTTACTTTGTCGACTACTTTATCGTG
CCCAAGACGGCCGAGGAAAGGGGTGACGCCATGTCTGTCGATGGTGACGAAGACGACGACGACGACGTCGACGAC
GCCACCCGCCGTCGCCGTTCAGGCATCAATCCCGTCTTTAGTGTCCGCCATCGGCGCTTTCACGACGTCAGCGAC
TGCGACCCGGACACGTGCGACTGGAAGTTGAACCGCAAGTCGCTCAAGATCTTGGACTGGCTTCGCGACCATTTC
GTACGGTACGCGTCTCAGAGCCACACCAGCCGCCACAAGACGCCCGAGAAGGTCTACTTTGGCCTCCTCGCCTGC
GAGTATGTCATTCCCACGCCCTCCCACCGACGCGACCCGCCCAAGACCCGAGTTAGACCGCCGAGTGACCGCCGA
CGGGGCACGCCCGGGGGGAGGATCGAAGCGGGACGGGCGGCACTCGCTCGTGCTTCACAATCAACTCCTCGGAGC
ATCTCTTCTTCTACTTCTGCTGCTTCCAGGCCTTTGAGCCGAATGAGCGGGGGATTGGTGACGGAGCCGGCCGCG
ACCTCAATGTACGTCTTTGGATCCGGCCGGGGGGACGACTTTCGATTTACGTTTTCACAGCCTTACGGGGGGGGT
TCGAGGTGGCTTGAGGCGTAG
Gene >Ophun1|2358
ATGGCTAGCATCAGGTTCGACGTGCCCGACGGCTGCCGCGTCTTCACGCTCTTTCCGCGGCTCCCCGCTGAACTG
CGCCACCGCATCTGGGAAGCCTATCTGTGCGACCCGGGCGTCAACTTCATCAAGCTTCAGGTCTGGGACCTCCAT
AGCGGTGCCTGGGGCAGACCCATGGTGCGCTCCCCCGCCGCAGAGGCCGCGGCTGCGGCAGCTGATGGCTCGGCT
GCCGAGGAACTGGACGACGTGGGCCGACTGCTTTTGCGCCACGACTGTCTCCCGCGGGTTTCCATCTTCTCTCGC
CTCGTTTCGAGTTACCCCAAAAACCCGTTGGCCGACCACTCGCAGCACCGCGAGTTGCGTGCCCGGCTGGCCGCC
ATGGCTGCAACCTGCGTCGAGTCCCACAGCCTTGTCCGCAGCCTGATGGCGAGGCCGGGCGTTTTGCGGCTTGAG
TCGGGTCTCTTTGTCTCCCTCAGCCGCTCTCCGGACGTGACGCTCCTGGAATATTACCCTCACGAGCTTTACAAG
GGGTCCGGTACTCTGAATGTCGACATCTTTTGCCCGACCCTCGACCTGATTCGCCGCCTCGCCGTTCGCTATTGT
CACGTATGGAGGCCCGAGGTGAAGGAATCCTGGTCCGGAGGCAAGCCCTGCCTCGAGGATCCCGGCAACTGCCCA
ACTCATCTATATCAGTTCCTCGCCAGGCATCTACCCAGCCTTCGCGAGTTTTACTTTGTCGACTACTTTATCGTG
CCCAAGACGGCCGAGGAAAGGGGTGACGCCATGTCTGTCGATGGTGACGAAGACGACGACGACGACGTCGACGAC
GCCACCCGCCGTCGCCGTTCAGGTGAGGCTCTTCCCGCCAATTCGCGTCAGACATGAAGCTGACGGCGATAATTA
GGCATCAATCCCGTCTTTAGTGTCCGCCATCGGCGCTTTCACGACGTCAGCGACTGCGACCCGGACACGTGCGAC
TGGAAGTTGAACCGCAAGTCGCTCAAGATCTTGGACTGGCTTCGCGACCATTTCGTACGGTACGCGTCTCAGAGC
CACACCAGCCGCCACAAGACGCCCGAGAAGGTCTACTTTGGCCTCCTCGCCTGCGAGTATGTCATTCCCACGCCC
TCCCACCGACGCGACCCGCCCAAGACCCGAGTTAGACCGCCGAGTGACCGCCGACGGGGCACGCCCGGGGGGAGG
ATCGAAGCGGGACGGGCGGCACTCGCTCGTGCTTCACAATCAACTCCTCGGAGCATCTCTTCTTCTACTTCTGCT
GCTTCCAGGCCTTTGAGCCGAATGAGCGGGGGATTGGTGACGGAGCCGGCCGCGACCTCAATGTACGTCTTTGGA
TCCGGCCGGGGGGACGACTTTCGATTTACGTTTTCACAGCCTTACGGGGGGGGTTCGAGGTGGCTTGAGGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail