Protein ID | Ophun1|2354 |
Gene name | |
Location | Contig_2147:92..648 |
Strand | + |
Gene length (bp) | 556 |
Transcript length (bp) | 435 |
Coding sequence length (bp) | 435 |
Protein length (aa) | 145 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00380 | Ribosomal_S9 | Ribosomal protein S9/S16 | 1.0E-34 | 12 | 144 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q759L8|RS16_ASHGO | 40S ribosomal protein S16 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPS16 PE=3 SV=1 | 3 | 144 | 8.0E-80 |
sp|P0CX52|RS16B_YEAST | 40S ribosomal protein S16-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS16B PE=1 SV=1 | 3 | 144 | 2.0E-79 |
sp|P0CX51|RS16A_YEAST | 40S ribosomal protein S16-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS16A PE=1 SV=1 | 3 | 144 | 2.0E-79 |
sp|Q6FR56|RS16_CANGA | 40S ribosomal protein S16 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPS16 PE=3 SV=1 | 3 | 144 | 9.0E-79 |
sp|Q875N2|RS16_KLULA | 40S ribosomal protein S16 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RPS16 PE=1 SV=1 | 3 | 144 | 2.0E-78 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q759L8|RS16_ASHGO | 40S ribosomal protein S16 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPS16 PE=3 SV=1 | 3 | 144 | 8.0E-80 |
sp|P0CX52|RS16B_YEAST | 40S ribosomal protein S16-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS16B PE=1 SV=1 | 3 | 144 | 2.0E-79 |
sp|P0CX51|RS16A_YEAST | 40S ribosomal protein S16-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS16A PE=1 SV=1 | 3 | 144 | 2.0E-79 |
sp|Q6FR56|RS16_CANGA | 40S ribosomal protein S16 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPS16 PE=3 SV=1 | 3 | 144 | 9.0E-79 |
sp|Q875N2|RS16_KLULA | 40S ribosomal protein S16 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RPS16 PE=1 SV=1 | 3 | 144 | 2.0E-78 |
sp|Q876B4|RS16_SACEX | 40S ribosomal protein S16 OS=Saccharomyces exiguus GN=RPS16 PE=3 SV=3 | 3 | 144 | 3.0E-78 |
sp|P0CT65|RS16B_SCHPO | 40S ribosomal protein S16-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1602 PE=3 SV=1 | 6 | 144 | 2.0E-77 |
sp|P0CT64|RS16A_SCHPO | 40S ribosomal protein S16-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1601 PE=2 SV=1 | 6 | 144 | 2.0E-77 |
sp|O94017|RS16_CANAX | 40S ribosomal protein S16 OS=Candida albicans GN=RPS16 PE=3 SV=1 | 4 | 144 | 3.0E-77 |
sp|Q6BSI7|RS16_DEBHA | 40S ribosomal protein S16 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RPS16 PE=3 SV=1 | 4 | 144 | 2.0E-76 |
sp|Q7SFJ9|RS16_NEUCR | 40S ribosomal protein S16 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rps-16 PE=3 SV=1 | 4 | 144 | 1.0E-75 |
sp|Q9SK22|RS161_ARATH | 40S ribosomal protein S16-1 OS=Arabidopsis thaliana GN=RPS16A PE=2 SV=1 | 4 | 144 | 8.0E-74 |
sp|Q42340|RS163_ARATH | 40S ribosomal protein S16-3 OS=Arabidopsis thaliana GN=RPS16C PE=2 SV=1 | 4 | 144 | 1.0E-73 |
sp|P46293|RS16_GOSHI | 40S ribosomal protein S16 OS=Gossypium hirsutum GN=RPS16 PE=2 SV=1 | 2 | 144 | 6.0E-73 |
sp|P62250|RS16_RAT | 40S ribosomal protein S16 OS=Rattus norvegicus GN=Rps16 PE=1 SV=2 | 6 | 144 | 3.0E-72 |
sp|Q29201|RS16_PIG | 40S ribosomal protein S16 OS=Sus scrofa GN=RPS16 PE=1 SV=4 | 6 | 144 | 3.0E-72 |
sp|P14131|RS16_MOUSE | 40S ribosomal protein S16 OS=Mus musculus GN=Rps16 PE=1 SV=4 | 6 | 144 | 3.0E-72 |
sp|P62249|RS16_HUMAN | 40S ribosomal protein S16 OS=Homo sapiens GN=RPS16 PE=1 SV=2 | 6 | 144 | 3.0E-72 |
sp|Q3T0X6|RS16_BOVIN | 40S ribosomal protein S16 OS=Bos taurus GN=RPS16 PE=2 SV=3 | 6 | 144 | 3.0E-72 |
sp|O22647|RS16_FRIAG | 40S ribosomal protein S16 OS=Fritillaria agrestis GN=RPS16 PE=2 SV=1 | 2 | 144 | 3.0E-72 |
sp|Q9W237|RS16_DROME | 40S ribosomal protein S16 OS=Drosophila melanogaster GN=RpS16 PE=1 SV=1 | 5 | 144 | 3.0E-72 |
sp|Q9M8X9|RS162_ARATH | 40S ribosomal protein S16-2 OS=Arabidopsis thaliana GN=RPS16B PE=2 SV=1 | 4 | 144 | 7.0E-72 |
sp|Q98TR7|RS16_HETFO | 40S ribosomal protein S16 OS=Heteropneustes fossilis GN=rps16 PE=2 SV=1 | 6 | 144 | 8.0E-72 |
sp|Q22054|RS16_CAEEL | 40S ribosomal protein S16 OS=Caenorhabditis elegans GN=rps-16 PE=1 SV=3 | 1 | 144 | 2.0E-71 |
sp|Q90YQ7|RS16_ICTPU | 40S ribosomal protein S16 OS=Ictalurus punctatus GN=rps16 PE=2 SV=1 | 6 | 144 | 2.0E-71 |
sp|P62251|RS16_AEDAE | 40S ribosomal protein S16 OS=Aedes aegypti GN=RpS16 PE=2 SV=1 | 5 | 144 | 2.0E-70 |
sp|Q95V31|RS16_SPOFR | 40S ribosomal protein S16 OS=Spodoptera frugiperda GN=RpS16 PE=2 SV=1 | 6 | 144 | 1.0E-69 |
sp|Q0IQF7|RS16_ORYSJ | 40S ribosomal protein S16 OS=Oryza sativa subsp. japonica GN=RPS16A PE=2 SV=1 | 7 | 144 | 2.0E-68 |
sp|A2ZB00|RS16_ORYSI | 40S ribosomal protein S16 OS=Oryza sativa subsp. indica GN=RPS16A PE=2 SV=1 | 7 | 144 | 2.0E-68 |
sp|Q9XEK7|RS16_TORRU | 40S ribosomal protein S16 OS=Tortula ruralis GN=RPS16 PE=2 SV=1 | 3 | 144 | 1.0E-67 |
sp|Q54Q51|RS16_DICDI | 40S ribosomal protein S16 OS=Dictyostelium discoideum GN=rps16 PE=3 SV=1 | 8 | 144 | 9.0E-64 |
sp|P16149|RS16_LUPPO | 40S ribosomal protein S16 OS=Lupinus polyphyllus GN=RPS16 PE=2 SV=1 | 28 | 144 | 9.0E-61 |
sp|Q2NFZ9|RS9_METST | 30S ribosomal protein S9 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rps9 PE=3 SV=1 | 5 | 144 | 1.0E-36 |
sp|Q9HQJ2|RS9_HALSA | 30S ribosomal protein S9 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps9 PE=3 SV=3 | 12 | 144 | 3.0E-36 |
sp|P05763|RS9_HALMA | 30S ribosomal protein S9 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps9 PE=1 SV=3 | 12 | 144 | 8.0E-35 |
sp|A0B6E8|RS9_METTP | 30S ribosomal protein S9 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rps9 PE=3 SV=1 | 8 | 144 | 1.0E-32 |
sp|Q8TT42|RS9_METAC | 30S ribosomal protein S9 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps9 PE=3 SV=1 | 8 | 144 | 2.0E-32 |
sp|Q8U0E7|RS9_PYRFU | 30S ribosomal protein S9 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps9 PE=1 SV=1 | 8 | 144 | 3.0E-32 |
sp|Q8PW44|RS9_METMA | 30S ribosomal protein S9 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps9 PE=3 SV=1 | 8 | 144 | 5.0E-32 |
sp|Q8TVB5|RS9_METKA | 30S ribosomal protein S9 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps9 PE=3 SV=1 | 8 | 144 | 2.0E-31 |
sp|Q5JJE2|RS9_THEKO | 30S ribosomal protein S9 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps9 PE=3 SV=1 | 8 | 144 | 2.0E-31 |
sp|Q9YB48|RS9_AERPE | 30S ribosomal protein S9 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps9 PE=3 SV=2 | 12 | 144 | 1.0E-29 |
sp|O29136|RS9_ARCFU | 30S ribosomal protein S9 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps9 PE=3 SV=1 | 3 | 144 | 2.0E-29 |
sp|Q9HL08|RS9_THEAC | 30S ribosomal protein S9 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps9 PE=3 SV=1 | 12 | 144 | 9.0E-29 |
sp|A6VGR2|RS9_METM7 | 30S ribosomal protein S9 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rps9 PE=3 SV=1 | 8 | 144 | 1.0E-28 |
sp|B8D6F5|RS9_DESK1 | 30S ribosomal protein S9 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=rps9 PE=3 SV=1 | 1 | 144 | 2.0E-28 |
sp|Q6LXM5|RS9_METMP | 30S ribosomal protein S9 OS=Methanococcus maripaludis (strain S2 / LL) GN=rps9 PE=3 SV=1 | 8 | 144 | 2.0E-28 |
sp|Q9V195|RS9_PYRAB | 30S ribosomal protein S9 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps9 PE=3 SV=1 | 8 | 144 | 6.0E-28 |
sp|O59299|RS9_PYRHO | 30S ribosomal protein S9 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps9 PE=3 SV=1 | 8 | 144 | 7.0E-28 |
sp|A4FWK9|RS9_METM5 | 30S ribosomal protein S9 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rps9 PE=3 SV=1 | 8 | 144 | 7.0E-28 |
sp|A6UPX0|RS9_METVS | 30S ribosomal protein S9 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rps9 PE=3 SV=1 | 8 | 144 | 2.0E-27 |
sp|Q979K1|RS9_THEVO | 30S ribosomal protein S9 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps9 PE=3 SV=1 | 8 | 144 | 2.0E-27 |
sp|O26146|RLSX_METTH | Fused L13/S9 ribosomal protein OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl13/rps9 PE=3 SV=1 | 8 | 144 | 6.0E-27 |
sp|Q6L293|RS9_PICTO | 30S ribosomal protein S9 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps9 PE=3 SV=1 | 12 | 144 | 4.0E-26 |
sp|C6A1B6|RS9_THESM | 30S ribosomal protein S9 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rps9 PE=3 SV=1 | 8 | 144 | 1.0E-25 |
sp|A6UW00|RS9_META3 | 30S ribosomal protein S9 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rps9 PE=3 SV=1 | 8 | 144 | 2.0E-25 |
sp|P54024|RS9_METJA | 30S ribosomal protein S9 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps9 PE=3 SV=1 | 8 | 144 | 2.0E-24 |
sp|Q8ZYQ0|RS9_PYRAE | 30S ribosomal protein S9 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps9 PE=3 SV=2 | 1 | 144 | 4.0E-23 |
sp|B3E0U1|RS9_METI4 | 30S ribosomal protein S9 OS=Methylacidiphilum infernorum (isolate V4) GN=rpsI PE=3 SV=1 | 8 | 144 | 1.0E-17 |
sp|A1VBD2|RS9_DESVV | 30S ribosomal protein S9 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-15 |
sp|Q728T3|RS9_DESVH | 30S ribosomal protein S9 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-15 |
sp|B8IZP3|RS9_DESDA | 30S ribosomal protein S9 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-15 |
sp|C6C1K0|RS9_DESAD | 30S ribosomal protein S9 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-15 |
sp|P95992|RS9_SULSO | 30S ribosomal protein S9 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps9 PE=3 SV=3 | 1 | 144 | 4.0E-15 |
sp|Q96YW3|RS9_SULTO | 30S ribosomal protein S9 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps9 PE=3 SV=1 | 1 | 144 | 8.0E-15 |
sp|B8DPL8|RS9_DESVM | 30S ribosomal protein S9 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-14 |
sp|Q1MQW3|RS9_LAWIP | 30S ribosomal protein S9 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rpsI PE=3 SV=1 | 4 | 144 | 3.0E-14 |
sp|A9EYT5|RS9_SORC5 | 30S ribosomal protein S9 OS=Sorangium cellulosum (strain So ce56) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-13 |
sp|A9BHB5|RS9_PETMO | 30S ribosomal protein S9 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-13 |
sp|B6YQS6|RS9_AZOPC | 30S ribosomal protein S9 OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=rpsI PE=3 SV=1 | 8 | 144 | 2.0E-13 |
sp|B3PBL9|RS9_CELJU | 30S ribosomal protein S9 OS=Cellvibrio japonicus (strain Ueda107) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-13 |
sp|Q30Y42|RS9_DESAG | 30S ribosomal protein S9 OS=Desulfovibrio alaskensis (strain G20) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-13 |
sp|B4UBJ2|RS9_ANASK | 30S ribosomal protein S9 OS=Anaeromyxobacter sp. (strain K) GN=rpsI PE=3 SV=1 | 4 | 144 | 4.0E-13 |
sp|Q2IEX8|RS9_ANADE | 30S ribosomal protein S9 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rpsI PE=3 SV=1 | 4 | 144 | 4.0E-13 |
sp|B8J5I5|RS9_ANAD2 | 30S ribosomal protein S9 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rpsI PE=3 SV=1 | 4 | 144 | 4.0E-13 |
sp|A0LXM9|RS9_GRAFK | 30S ribosomal protein S9 OS=Gramella forsetii (strain KT0803) GN=rpsI PE=3 SV=1 | 6 | 144 | 4.0E-13 |
sp|Q5P7T8|RS9_AROAE | 30S ribosomal protein S9 OS=Aromatoleum aromaticum (strain EbN1) GN=rpsI PE=3 SV=1 | 12 | 144 | 5.0E-13 |
sp|Q7VUV9|RS9_BORPE | 30S ribosomal protein S9 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-12 |
sp|C4XNQ1|RS9_DESMR | 30S ribosomal protein S9 OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-12 |
sp|Q3A3B7|RS9_PELCD | 30S ribosomal protein S9 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rpsI PE=3 SV=1 | 4 | 144 | 2.0E-12 |
sp|Q7VIV5|RS9_HELHP | 30S ribosomal protein S9 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rpsI PE=3 SV=1 | 8 | 144 | 2.0E-12 |
sp|Q661S9|RS9_BORBP | 30S ribosomal protein S9 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-12 |
sp|Q2KV03|RS9_BORA1 | 30S ribosomal protein S9 OS=Bordetella avium (strain 197N) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-12 |
sp|Q0SNH4|RS9_BORAP | 30S ribosomal protein S9 OS=Borrelia afzelii (strain PKo) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-12 |
sp|A9I240|RS9_BORPD | 30S ribosomal protein S9 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-12 |
sp|A1BHZ6|RS9_CHLPD | 30S ribosomal protein S9 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rpsI PE=3 SV=1 | 6 | 144 | 3.0E-12 |
sp|B7J1R3|RS9_BORBZ | 30S ribosomal protein S9 OS=Borrelia burgdorferi (strain ZS7) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-12 |
sp|O51313|RS9_BORBU | 30S ribosomal protein S9 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-12 |
sp|Q7WFC4|RS9_BORBR | 30S ribosomal protein S9 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-12 |
sp|Q0AHZ9|RS9_NITEC | 30S ribosomal protein S9 OS=Nitrosomonas eutropha (strain C91) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-12 |
sp|C1DQ79|RS9_AZOVD | 30S ribosomal protein S9 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rpsI PE=3 SV=1 | 3 | 144 | 4.0E-12 |
sp|A6GWU3|RS9_FLAPJ | 30S ribosomal protein S9 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rpsI PE=3 SV=1 | 7 | 144 | 4.0E-12 |
sp|B1J1W9|RS9_PSEPW | 30S ribosomal protein S9 OS=Pseudomonas putida (strain W619) GN=rpsI PE=3 SV=1 | 3 | 144 | 5.0E-12 |
sp|Q7W3Z2|RS9_BORPA | 30S ribosomal protein S9 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rpsI PE=3 SV=1 | 12 | 144 | 5.0E-12 |
sp|Q5HSV2|RS9_CAMJR | 30S ribosomal protein S9 OS=Campylobacter jejuni (strain RM1221) GN=rpsI PE=3 SV=1 | 12 | 144 | 7.0E-12 |
sp|A1W187|RS9_CAMJJ | 30S ribosomal protein S9 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rpsI PE=3 SV=1 | 12 | 144 | 7.0E-12 |
sp|Q9PMI3|RS9_CAMJE | 30S ribosomal protein S9 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rpsI PE=3 SV=1 | 12 | 144 | 7.0E-12 |
sp|A7H5K0|RS9_CAMJD | 30S ribosomal protein S9 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=rpsI PE=3 SV=1 | 12 | 144 | 7.0E-12 |
sp|A8FNE5|RS9_CAMJ8 | 30S ribosomal protein S9 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rpsI PE=3 SV=1 | 12 | 144 | 7.0E-12 |
sp|B9KFA8|RS9_CAMLR | 30S ribosomal protein S9 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=rpsI PE=3 SV=1 | 12 | 144 | 8.0E-12 |
sp|Q3B5U1|RS9_CHLL7 | 30S ribosomal protein S9 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rpsI PE=3 SV=1 | 6 | 144 | 9.0E-12 |
sp|Q11QN5|RS9_CYTH3 | 30S ribosomal protein S9 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=rpsI PE=3 SV=1 | 6 | 144 | 1.0E-11 |
sp|B7GJ32|RS9_ANOFW | 30S ribosomal protein S9 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-11 |
sp|A7HXB2|RS9_PARL1 | 30S ribosomal protein S9 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-11 |
sp|Q82UK1|RS9_NITEU | 30S ribosomal protein S9 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-11 |
sp|B3EFY3|RS9_CHLL2 | 30S ribosomal protein S9 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rpsI PE=3 SV=1 | 6 | 144 | 2.0E-11 |
sp|A4VIF8|RS9_PSEU5 | 30S ribosomal protein S9 OS=Pseudomonas stutzeri (strain A1501) GN=rpsI PE=3 SV=1 | 3 | 144 | 2.0E-11 |
sp|Q2YBK3|RS9_NITMU | 30S ribosomal protein S9 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-11 |
sp|Q88N96|RS9_PSEPK | 30S ribosomal protein S9 OS=Pseudomonas putida (strain KT2440) GN=rpsI PE=3 SV=1 | 3 | 144 | 2.0E-11 |
sp|A5W8S0|RS9_PSEP1 | 30S ribosomal protein S9 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpsI PE=3 SV=1 | 3 | 144 | 2.0E-11 |
sp|B2IK87|RS9_BEII9 | 30S ribosomal protein S9 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-11 |
sp|A0LIV3|RS9_SYNFM | 30S ribosomal protein S9 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rpsI PE=3 SV=1 | 4 | 144 | 2.0E-11 |
sp|A6L0V0|RS9_BACV8 | 30S ribosomal protein S9 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rpsI PE=3 SV=1 | 8 | 144 | 3.0E-11 |
sp|B0KFU7|RS9_PSEPG | 30S ribosomal protein S9 OS=Pseudomonas putida (strain GB-1) GN=rpsI PE=3 SV=1 | 3 | 144 | 3.0E-11 |
sp|Q1I597|RS9_PSEE4 | 30S ribosomal protein S9 OS=Pseudomonas entomophila (strain L48) GN=rpsI PE=3 SV=1 | 3 | 144 | 3.0E-11 |
sp|Q3K724|RS9_PSEPF | 30S ribosomal protein S9 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rpsI PE=3 SV=1 | 3 | 144 | 3.0E-11 |
sp|B6JPI5|RS9_HELP2 | 30S ribosomal protein S9 OS=Helicobacter pylori (strain P12) GN=rpsI PE=3 SV=1 | 8 | 144 | 3.0E-11 |
sp|C3K6E2|RS9_PSEFS | 30S ribosomal protein S9 OS=Pseudomonas fluorescens (strain SBW25) GN=rpsI PE=3 SV=1 | 3 | 144 | 4.0E-11 |
sp|Q4ZNX3|RS9_PSEU2 | 30S ribosomal protein S9 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rpsI PE=3 SV=1 | 3 | 144 | 4.0E-11 |
sp|Q87WW8|RS9_PSESM | 30S ribosomal protein S9 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rpsI PE=3 SV=1 | 3 | 144 | 4.0E-11 |
sp|Q48EE1|RS9_PSE14 | 30S ribosomal protein S9 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rpsI PE=3 SV=1 | 3 | 144 | 4.0E-11 |
sp|Q475T2|RS9_CUPPJ | 30S ribosomal protein S9 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rpsI PE=3 SV=1 | 12 | 144 | 5.0E-11 |
sp|A1K970|RS9_AZOSB | 30S ribosomal protein S9 OS=Azoarcus sp. (strain BH72) GN=rpsI PE=3 SV=1 | 12 | 144 | 5.0E-11 |
sp|P66637|RS9_HELPY | 30S ribosomal protein S9 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rpsI PE=3 SV=1 | 8 | 144 | 5.0E-11 |
sp|P66638|RS9_HELPJ | 30S ribosomal protein S9 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rpsI PE=3 SV=1 | 8 | 144 | 5.0E-11 |
sp|B5Z683|RS9_HELPG | 30S ribosomal protein S9 OS=Helicobacter pylori (strain G27) GN=rpsI PE=3 SV=1 | 8 | 144 | 5.0E-11 |
sp|A1U3H7|RS9_MARHV | 30S ribosomal protein S9 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpsI PE=3 SV=1 | 12 | 144 | 5.0E-11 |
sp|B2AH58|RS9_CUPTR | 30S ribosomal protein S9 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rpsI PE=3 SV=1 | 12 | 144 | 5.0E-11 |
sp|A1RNJ7|RS9_SHESW | 30S ribosomal protein S9 OS=Shewanella sp. (strain W3-18-1) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-11 |
sp|Q0HYX4|RS9_SHESR | 30S ribosomal protein S9 OS=Shewanella sp. (strain MR-7) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-11 |
sp|Q0HF31|RS9_SHESM | 30S ribosomal protein S9 OS=Shewanella sp. (strain MR-4) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-11 |
sp|A0KT12|RS9_SHESA | 30S ribosomal protein S9 OS=Shewanella sp. (strain ANA-3) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-11 |
sp|A4Y3E2|RS9_SHEPC | 30S ribosomal protein S9 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-11 |
sp|Q8EAG3|RS9_SHEON | 30S ribosomal protein S9 OS=Shewanella oneidensis (strain MR-1) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-11 |
sp|A9L112|RS9_SHEB9 | 30S ribosomal protein S9 OS=Shewanella baltica (strain OS195) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-11 |
sp|A6WJ71|RS9_SHEB8 | 30S ribosomal protein S9 OS=Shewanella baltica (strain OS185) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-11 |
sp|A3D8R3|RS9_SHEB5 | 30S ribosomal protein S9 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-11 |
sp|B8E9M8|RS9_SHEB2 | 30S ribosomal protein S9 OS=Shewanella baltica (strain OS223) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-11 |
sp|A4XQQ4|RS9_PSEMY | 30S ribosomal protein S9 OS=Pseudomonas mendocina (strain ymp) GN=rpsI PE=3 SV=1 | 3 | 144 | 6.0E-11 |
sp|Q7M7R1|RS9_WOLSU | 30S ribosomal protein S9 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rpsI PE=3 SV=1 | 8 | 144 | 6.0E-11 |
sp|Q0KED8|RS9_CUPNH | 30S ribosomal protein S9 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-11 |
sp|A6VXZ2|RS9_MARMS | 30S ribosomal protein S9 OS=Marinomonas sp. (strain MWYL1) GN=rpsI PE=3 SV=1 | 3 | 144 | 6.0E-11 |
sp|B2URR4|RS9_HELPS | 30S ribosomal protein S9 OS=Helicobacter pylori (strain Shi470) GN=rpsI PE=3 SV=1 | 8 | 144 | 6.0E-11 |
sp|Q17VT4|RS9_HELAH | 30S ribosomal protein S9 OS=Helicobacter acinonychis (strain Sheeba) GN=rpsI PE=3 SV=1 | 8 | 144 | 7.0E-11 |
sp|Q8Y245|RS9_RALSO | 30S ribosomal protein S9 OS=Ralstonia solanacearum (strain GMI1000) GN=rpsI PE=3 SV=1 | 12 | 144 | 7.0E-11 |
sp|Q0A6F4|RS9_ALKEH | 30S ribosomal protein S9 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rpsI PE=3 SV=1 | 4 | 144 | 7.0E-11 |
sp|Q1CV71|RS9_HELPH | 30S ribosomal protein S9 OS=Helicobacter pylori (strain HPAG1) GN=rpsI PE=3 SV=1 | 8 | 144 | 8.0E-11 |
sp|Q64P28|RS9_BACFR | 30S ribosomal protein S9 OS=Bacteroides fragilis (strain YCH46) GN=rpsI PE=3 SV=1 | 6 | 144 | 8.0E-11 |
sp|Q5L8W6|RS9_BACFN | 30S ribosomal protein S9 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rpsI PE=3 SV=1 | 6 | 144 | 8.0E-11 |
sp|A1SA66|RS9_SHEAM | 30S ribosomal protein S9 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-10 |
sp|Q15PI4|RS9_PSEA6 | 30S ribosomal protein S9 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-10 |
sp|C1A3Z4|RS9_GEMAT | 30S ribosomal protein S9 OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=rpsI PE=3 SV=1 | 5 | 144 | 1.0E-10 |
sp|A9W606|RS9_METEP | 30S ribosomal protein S9 OS=Methylobacterium extorquens (strain PA1) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-10 |
sp|B7KPU6|RS9_METC4 | 30S ribosomal protein S9 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-10 |
sp|C3MA32|RS9_RHISN | 30S ribosomal protein S9 OS=Rhizobium sp. (strain NGR234) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-10 |
sp|C5BS65|RS9_TERTT | 30S ribosomal protein S9 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-10 |
sp|B0UQW5|RS9_METS4 | 30S ribosomal protein S9 OS=Methylobacterium sp. (strain 4-46) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-10 |
sp|Q3SF20|RS9_THIDA | 30S ribosomal protein S9 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-10 |
sp|Q5L5W2|RS9_CHLAB | 30S ribosomal protein S9 OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-10 |
sp|A7GK54|RS9_BACCN | 30S ribosomal protein S9 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-10 |
sp|Q13UB3|RS9_BURXL | 30S ribosomal protein S9 OS=Burkholderia xenovorans (strain LB400) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-10 |
sp|B2SYK9|RS9_BURPP | 30S ribosomal protein S9 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-10 |
sp|Q81VP8|RS9_BACAN | 30S ribosomal protein S9 OS=Bacillus anthracis GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-10 |
sp|C3LJX8|RS9_BACAC | 30S ribosomal protein S9 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-10 |
sp|C3PAK4|RS9_BACAA | 30S ribosomal protein S9 OS=Bacillus anthracis (strain A0248) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-10 |
sp|B0K5S8|RS9_THEPX | 30S ribosomal protein S9 OS=Thermoanaerobacter sp. (strain X514) GN=rpsI PE=3 SV=1 | 7 | 144 | 2.0E-10 |
sp|B0KCN5|RS9_THEP3 | 30S ribosomal protein S9 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpsI PE=3 SV=1 | 7 | 144 | 2.0E-10 |
sp|Q1LRC9|RS9_CUPMC | 30S ribosomal protein S9 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-10 |
sp|Q8R7Y9|RS9_CALS4 | 30S ribosomal protein S9 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-10 |
sp|Q2RSE4|RS9_RHORT | 30S ribosomal protein S9 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-10 |
sp|Q8A0Z5|RS9_BACTN | 30S ribosomal protein S9 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpsI PE=3 SV=1 | 6 | 144 | 3.0E-10 |
sp|B8F3F7|RS9_HAEPS | 30S ribosomal protein S9 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rpsI PE=3 SV=1 | 1 | 144 | 3.0E-10 |
sp|A8ZWE7|RS9_DESOH | 30S ribosomal protein S9 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=rpsI PE=3 SV=1 | 6 | 144 | 3.0E-10 |
sp|Q9PKR2|RS9_CHLMU | 30S ribosomal protein S9 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-10 |
sp|Q32BA9|RS9_SHIDS | 30S ribosomal protein S9 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-10 |
sp|A3QI61|RS9_SHELP | 30S ribosomal protein S9 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rpsI PE=3 SV=1 | 3 | 144 | 3.0E-10 |
sp|B8CIP3|RS9_SHEPW | 30S ribosomal protein S9 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-10 |
sp|C4K5S1|RS9_HAMD5 | 30S ribosomal protein S9 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-10 |
sp|Q6HPM5|RS9_BACHK | 30S ribosomal protein S9 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-10 |
sp|Q63H57|RS9_BACCZ | 30S ribosomal protein S9 OS=Bacillus cereus (strain ZK / E33L) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-10 |
sp|Q81J12|RS9_BACCR | 30S ribosomal protein S9 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-10 |
sp|B9IZM8|RS9_BACCQ | 30S ribosomal protein S9 OS=Bacillus cereus (strain Q1) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-10 |
sp|B7HQX8|RS9_BACC7 | 30S ribosomal protein S9 OS=Bacillus cereus (strain AH187) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-10 |
sp|B7HJJ1|RS9_BACC4 | 30S ribosomal protein S9 OS=Bacillus cereus (strain B4264) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-10 |
sp|C1ET73|RS9_BACC3 | 30S ribosomal protein S9 OS=Bacillus cereus (strain 03BB102) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-10 |
sp|B7IT53|RS9_BACC2 | 30S ribosomal protein S9 OS=Bacillus cereus (strain G9842) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-10 |
sp|Q73F62|RS9_BACC1 | 30S ribosomal protein S9 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-10 |
sp|B7JKF4|RS9_BACC0 | 30S ribosomal protein S9 OS=Bacillus cereus (strain AH820) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-10 |
sp|A0R8L3|RS9_BACAH | 30S ribosomal protein S9 OS=Bacillus thuringiensis (strain Al Hakam) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-10 |
sp|B2JGV1|RS9_BURP8 | 30S ribosomal protein S9 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-10 |
sp|Q822Z3|RS9_CHLCV | 30S ribosomal protein S9 OS=Chlamydophila caviae (strain GPIC) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-10 |
sp|A2SKM0|RS9_METPP | 30S ribosomal protein S9 OS=Methylibium petroleiphilum (strain PM1) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-10 |
sp|Q7N079|RS9_PHOLL | 30S ribosomal protein S9 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-10 |
sp|Q2S9X3|RS9_HAHCH | 30S ribosomal protein S9 OS=Hahella chejuensis (strain KCTC 2396) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-10 |
sp|Q47VT2|RS9_COLP3 | 30S ribosomal protein S9 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-10 |
sp|C4LCK6|RS9_TOLAT | 30S ribosomal protein S9 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-10 |
sp|Q7VLF7|RS9_HAEDU | 30S ribosomal protein S9 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpsI PE=3 SV=1 | 1 | 144 | 5.0E-10 |
sp|O84128|RS9_CHLTR | 30S ribosomal protein S9 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpsI PE=3 SV=1 | 12 | 144 | 5.0E-10 |
sp|Q3KMP3|RS9_CHLTA | 30S ribosomal protein S9 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rpsI PE=3 SV=1 | 12 | 144 | 5.0E-10 |
sp|Q9Z8T8|RS9_CHLPN | 30S ribosomal protein S9 OS=Chlamydia pneumoniae GN=rpsI PE=3 SV=1 | 3 | 144 | 5.0E-10 |
sp|Q254P0|RS9_CHLFF | 30S ribosomal protein S9 OS=Chlamydophila felis (strain Fe/C-56) GN=rpsI PE=3 SV=1 | 2 | 144 | 6.0E-10 |
sp|B4RQK5|RS9_NEIG2 | 30S ribosomal protein S9 OS=Neisseria gonorrhoeae (strain NCCP11945) GN=rpsI PE=3 SV=1 | 12 | 143 | 6.0E-10 |
sp|Q5F5A4|RS9_NEIG1 | 30S ribosomal protein S9 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rpsI PE=3 SV=1 | 12 | 143 | 6.0E-10 |
sp|B1ZCB4|RS9_METPB | 30S ribosomal protein S9 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-10 |
sp|A6LHM6|RS9_PARD8 | 30S ribosomal protein S9 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpsI PE=3 SV=1 | 6 | 144 | 6.0E-10 |
sp|B9JVC4|RS9_AGRVS | 30S ribosomal protein S9 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-10 |
sp|B6J4Q5|RS9_COXB1 | 30S ribosomal protein S9 OS=Coxiella burnetii (strain CbuK_Q154) GN=rpsI PE=3 SV=1 | 11 | 144 | 6.0E-10 |
sp|Q2NWI3|RS9_SODGM | 30S ribosomal protein S9 OS=Sodalis glossinidius (strain morsitans) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-10 |
sp|B0BBB3|RS9_CHLTB | 30S ribosomal protein S9 OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-10 |
sp|B0B9N4|RS9_CHLT2 | 30S ribosomal protein S9 OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-10 |
sp|Q83AX9|RS9_COXBU | 30S ribosomal protein S9 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpsI PE=3 SV=1 | 12 | 144 | 7.0E-10 |
sp|A9NAB0|RS9_COXBR | 30S ribosomal protein S9 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rpsI PE=3 SV=1 | 12 | 144 | 7.0E-10 |
sp|A9KBY1|RS9_COXBN | 30S ribosomal protein S9 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rpsI PE=3 SV=1 | 12 | 144 | 7.0E-10 |
sp|B6J2V0|RS9_COXB2 | 30S ribosomal protein S9 OS=Coxiella burnetii (strain CbuG_Q212) GN=rpsI PE=3 SV=1 | 12 | 144 | 7.0E-10 |
sp|Q6FZQ5|RS9_BARQU | 30S ribosomal protein S9 OS=Bartonella quintana (strain Toulouse) GN=rpsI PE=3 SV=1 | 12 | 144 | 7.0E-10 |
sp|B1KSI9|RS9_CLOBM | 30S ribosomal protein S9 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rpsI PE=3 SV=1 | 8 | 144 | 8.0E-10 |
sp|A7GJ38|RS9_CLOBL | 30S ribosomal protein S9 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rpsI PE=3 SV=1 | 8 | 144 | 8.0E-10 |
sp|B1IGB8|RS9_CLOBK | 30S ribosomal protein S9 OS=Clostridium botulinum (strain Okra / Type B1) GN=rpsI PE=3 SV=1 | 8 | 144 | 8.0E-10 |
sp|C1FMR5|RS9_CLOBJ | 30S ribosomal protein S9 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=rpsI PE=3 SV=1 | 8 | 144 | 8.0E-10 |
sp|A5I7H0|RS9_CLOBH | 30S ribosomal protein S9 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rpsI PE=3 SV=1 | 8 | 144 | 8.0E-10 |
sp|C3KVL5|RS9_CLOB6 | 30S ribosomal protein S9 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=rpsI PE=3 SV=1 | 8 | 144 | 8.0E-10 |
sp|A7FZ37|RS9_CLOB1 | 30S ribosomal protein S9 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rpsI PE=3 SV=1 | 8 | 144 | 8.0E-10 |
sp|B1KII1|RS9_SHEWM | 30S ribosomal protein S9 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rpsI PE=3 SV=1 | 12 | 144 | 8.0E-10 |
sp|A8FR86|RS9_SHESH | 30S ribosomal protein S9 OS=Shewanella sediminis (strain HAW-EB3) GN=rpsI PE=3 SV=1 | 12 | 144 | 8.0E-10 |
sp|B0BUG0|RS9_ACTPJ | 30S ribosomal protein S9 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rpsI PE=3 SV=1 | 1 | 144 | 8.0E-10 |
sp|B3H130|RS9_ACTP7 | 30S ribosomal protein S9 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rpsI PE=3 SV=1 | 1 | 144 | 8.0E-10 |
sp|Q9A8H6|RS9_CAUCR | 30S ribosomal protein S9 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rpsI PE=3 SV=1 | 12 | 144 | 9.0E-10 |
sp|B8H554|RS9_CAUCN | 30S ribosomal protein S9 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rpsI PE=3 SV=1 | 12 | 144 | 9.0E-10 |
sp|Q2SZ68|RS9_BURTA | 30S ribosomal protein S9 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rpsI PE=3 SV=1 | 12 | 144 | 9.0E-10 |
sp|P59514|RS9_BUCBP | 30S ribosomal protein S9 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rpsI PE=3 SV=1 | 12 | 144 | 9.0E-10 |
sp|B8IUF0|RS9_METNO | 30S ribosomal protein S9 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-09 |
sp|A8H8M0|RS9_SHEPA | 30S ribosomal protein S9 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-09 |
sp|C0PZN9|RS9_SALPC | 30S ribosomal protein S9 OS=Salmonella paratyphi C (strain RKS4594) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-09 |
sp|A0KPZ2|RS9_AERHH | 30S ribosomal protein S9 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-09 |
sp|Q9KGD4|RS9_BACHD | 30S ribosomal protein S9 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-09 |
sp|Q92QR5|RS9_RHIME | 30S ribosomal protein S9 OS=Rhizobium meliloti (strain 1021) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-09 |
sp|B8ENN1|RS9_METSB | 30S ribosomal protein S9 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-09 |
sp|B0TUV6|RS9_SHEHH | 30S ribosomal protein S9 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-09 |
sp|P39468|RS9_SULAC | 30S ribosomal protein S9 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps9 PE=3 SV=2 | 1 | 144 | 2.0E-09 |
sp|A1KWD5|RS9_NEIMF | 30S ribosomal protein S9 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rpsI PE=3 SV=1 | 12 | 143 | 2.0E-09 |
sp|P66642|RS9_NEIMB | 30S ribosomal protein S9 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rpsI PE=3 SV=1 | 12 | 143 | 2.0E-09 |
sp|P66641|RS9_NEIMA | 30S ribosomal protein S9 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rpsI PE=3 SV=1 | 12 | 143 | 2.0E-09 |
sp|A9M088|RS9_NEIM0 | 30S ribosomal protein S9 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rpsI PE=3 SV=1 | 12 | 143 | 2.0E-09 |
sp|Q0BI90|RS9_BURCM | 30S ribosomal protein S9 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|B1YTD2|RS9_BURA4 | 30S ribosomal protein S9 OS=Burkholderia ambifaria (strain MC40-6) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|A9VPB1|RS9_BACWK | 30S ribosomal protein S9 OS=Bacillus weihenstephanensis (strain KBAB4) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|Q0T058|RS9_SHIF8 | 30S ribosomal protein S9 OS=Shigella flexneri serotype 5b (strain 8401) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|Q31W98|RS9_SHIBS | 30S ribosomal protein S9 OS=Shigella boydii serotype 4 (strain Sb227) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|B2U1V5|RS9_SHIB3 | 30S ribosomal protein S9 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|A6TEN8|RS9_KLEP7 | 30S ribosomal protein S9 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|Q1R6B0|RS9_ECOUT | 30S ribosomal protein S9 OS=Escherichia coli (strain UTI89 / UPEC) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|B1LGJ6|RS9_ECOSM | 30S ribosomal protein S9 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|B6I1U8|RS9_ECOSE | 30S ribosomal protein S9 OS=Escherichia coli (strain SE11) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|B7NDK8|RS9_ECOLU | 30S ribosomal protein S9 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|P0A7X3|RS9_ECOLI | 30S ribosomal protein S9 OS=Escherichia coli (strain K12) GN=rpsI PE=1 SV=2 | 12 | 144 | 2.0E-09 |
sp|B1IQP9|RS9_ECOLC | 30S ribosomal protein S9 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|P0A7X4|RS9_ECOL6 | 30S ribosomal protein S9 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpsI PE=3 SV=2 | 12 | 144 | 2.0E-09 |
sp|Q0TCN6|RS9_ECOL5 | 30S ribosomal protein S9 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|A1AGC3|RS9_ECOK1 | 30S ribosomal protein S9 OS=Escherichia coli O1:K1 / APEC GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|A8A539|RS9_ECOHS | 30S ribosomal protein S9 OS=Escherichia coli O9:H4 (strain HS) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|B1XHK3|RS9_ECODH | 30S ribosomal protein S9 OS=Escherichia coli (strain K12 / DH10B) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|C4ZSW8|RS9_ECOBW | 30S ribosomal protein S9 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|B7M0U2|RS9_ECO8A | 30S ribosomal protein S9 OS=Escherichia coli O8 (strain IAI1) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|B7N102|RS9_ECO81 | 30S ribosomal protein S9 OS=Escherichia coli O81 (strain ED1a) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|B7NKU2|RS9_ECO7I | 30S ribosomal protein S9 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|B5YSV6|RS9_ECO5E | 30S ribosomal protein S9 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|P0A7X5|RS9_ECO57 | 30S ribosomal protein S9 OS=Escherichia coli O157:H7 GN=rpsI PE=3 SV=2 | 12 | 144 | 2.0E-09 |
sp|B7LHT8|RS9_ECO55 | 30S ribosomal protein S9 OS=Escherichia coli (strain 55989 / EAEC) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|B7MBZ1|RS9_ECO45 | 30S ribosomal protein S9 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|B7UJW2|RS9_ECO27 | 30S ribosomal protein S9 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|A7ZSC4|RS9_ECO24 | 30S ribosomal protein S9 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|A8AQC0|RS9_CITK8 | 30S ribosomal protein S9 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|Q9CNB1|RS9_PASMU | 30S ribosomal protein S9 OS=Pasteurella multocida (strain Pm70) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|Q63QW4|RS9_BURPS | 30S ribosomal protein S9 OS=Burkholderia pseudomallei (strain K96243) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|A3NDG7|RS9_BURP6 | 30S ribosomal protein S9 OS=Burkholderia pseudomallei (strain 668) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|Q3JNR2|RS9_BURP1 | 30S ribosomal protein S9 OS=Burkholderia pseudomallei (strain 1710b) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|A3NZ79|RS9_BURP0 | 30S ribosomal protein S9 OS=Burkholderia pseudomallei (strain 1106a) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|A1V052|RS9_BURMS | 30S ribosomal protein S9 OS=Burkholderia mallei (strain SAVP1) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|Q62HB9|RS9_BURMA | 30S ribosomal protein S9 OS=Burkholderia mallei (strain ATCC 23344) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|A2S582|RS9_BURM9 | 30S ribosomal protein S9 OS=Burkholderia mallei (strain NCTC 10229) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|A3MP60|RS9_BURM7 | 30S ribosomal protein S9 OS=Burkholderia mallei (strain NCTC 10247) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|B2VGU9|RS9_ERWT9 | 30S ribosomal protein S9 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|A4WF42|RS9_ENT38 | 30S ribosomal protein S9 OS=Enterobacter sp. (strain 638) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|B0T0S3|RS9_CAUSK | 30S ribosomal protein S9 OS=Caulobacter sp. (strain K31) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|A5IMD2|RS9_THEP1 | 30S ribosomal protein S9 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|B4EXM0|RS9_PROMH | 30S ribosomal protein S9 OS=Proteus mirabilis (strain HI4320) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|Q5WLM8|RS9_BACSK | 30S ribosomal protein S9 OS=Bacillus clausii (strain KSM-K16) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|B9K8D3|RS9_THENN | 30S ribosomal protein S9 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|B1M201|RS9_METRJ | 30S ribosomal protein S9 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-09 |
sp|A0L481|RS9_MAGMM | 30S ribosomal protein S9 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rpsI PE=3 SV=1 | 4 | 144 | 2.0E-09 |
sp|Q1AU64|RS9_RUBXD | 30S ribosomal protein S9 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|P66643|RS9_SALTY | 30S ribosomal protein S9 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpsI PE=1 SV=2 | 12 | 144 | 3.0E-09 |
sp|P66644|RS9_SALTI | 30S ribosomal protein S9 OS=Salmonella typhi GN=rpsI PE=3 SV=2 | 12 | 144 | 3.0E-09 |
sp|B4TWJ4|RS9_SALSV | 30S ribosomal protein S9 OS=Salmonella schwarzengrund (strain CVM19633) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|B5BGP9|RS9_SALPK | 30S ribosomal protein S9 OS=Salmonella paratyphi A (strain AKU_12601) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|A9N839|RS9_SALPB | 30S ribosomal protein S9 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|Q5PJS6|RS9_SALPA | 30S ribosomal protein S9 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|B4T754|RS9_SALNS | 30S ribosomal protein S9 OS=Salmonella newport (strain SL254) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|B4TJR8|RS9_SALHS | 30S ribosomal protein S9 OS=Salmonella heidelberg (strain SL476) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|B5R0L7|RS9_SALEP | 30S ribosomal protein S9 OS=Salmonella enteritidis PT4 (strain P125109) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|B5FIS2|RS9_SALDC | 30S ribosomal protein S9 OS=Salmonella dublin (strain CT_02021853) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|Q57JC4|RS9_SALCH | 30S ribosomal protein S9 OS=Salmonella choleraesuis (strain SC-B67) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|A9MNY1|RS9_SALAR | 30S ribosomal protein S9 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|B5F7K4|RS9_SALA4 | 30S ribosomal protein S9 OS=Salmonella agona (strain SL483) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|B5XSS2|RS9_KLEP3 | 30S ribosomal protein S9 OS=Klebsiella pneumoniae (strain 342) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|B7LRJ8|RS9_ESCF3 | 30S ribosomal protein S9 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|C4ZI84|RS9_EUBR3 | 30S ribosomal protein S9 OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=rpsI PE=3 SV=1 | 4 | 144 | 3.0E-09 |
sp|Q9X1G4|RS9_THEMA | 30S ribosomal protein S9 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|Q3YX18|RS9_SHISS | 30S ribosomal protein S9 OS=Shigella sonnei (strain Ss046) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|A4SHZ5|RS9_AERS4 | 30S ribosomal protein S9 OS=Aeromonas salmonicida (strain A449) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|B1LBJ1|RS9_THESQ | 30S ribosomal protein S9 OS=Thermotoga sp. (strain RQ2) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|Q83Q07|RS9_SHIFL | 30S ribosomal protein S9 OS=Shigella flexneri GN=rpsI PE=3 SV=3 | 12 | 144 | 3.0E-09 |
sp|P31782|RS9_HISSO | 30S ribosomal protein S9 OS=Histophilus somni GN=rpsI PE=3 SV=2 | 12 | 144 | 3.0E-09 |
sp|B0UTU5|RS9_HISS2 | 30S ribosomal protein S9 OS=Histophilus somni (strain 2336) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|Q0I2N2|RS9_HAES1 | 30S ribosomal protein S9 OS=Haemophilus somnus (strain 129Pt) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|A6Q5F6|RS9_NITSB | 30S ribosomal protein S9 OS=Nitratiruptor sp. (strain SB155-2) GN=rpsI PE=3 SV=1 | 8 | 144 | 3.0E-09 |
sp|Q21FV9|RS9_SACD2 | 30S ribosomal protein S9 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|A6U7T6|RS9_SINMW | 30S ribosomal protein S9 OS=Sinorhizobium medicae (strain WSM419) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|B1JL67|RS9_YERPY | 30S ribosomal protein S9 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|Q665L0|RS9_YERPS | 30S ribosomal protein S9 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|A4THJ2|RS9_YERPP | 30S ribosomal protein S9 OS=Yersinia pestis (strain Pestoides F) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|Q1CE09|RS9_YERPN | 30S ribosomal protein S9 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|A9R1R9|RS9_YERPG | 30S ribosomal protein S9 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|Q8ZB62|RS9_YERPE | 30S ribosomal protein S9 OS=Yersinia pestis GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|B2K3Z6|RS9_YERPB | 30S ribosomal protein S9 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|Q1C1G9|RS9_YERPA | 30S ribosomal protein S9 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|A7FDX5|RS9_YERP3 | 30S ribosomal protein S9 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-09 |
sp|A3MZW7|RS9_ACTP2 | 30S ribosomal protein S9 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpsI PE=3 SV=1 | 1 | 144 | 3.0E-09 |
sp|A9AH80|RS9_BURM1 | 30S ribosomal protein S9 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-09 |
sp|A0PXY2|RS9_CLONN | 30S ribosomal protein S9 OS=Clostridium novyi (strain NT) GN=rpsI PE=3 SV=1 | 8 | 144 | 4.0E-09 |
sp|Q7UEY4|RS9_RHOBA | 30S ribosomal protein S9 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-09 |
sp|P82933|RT09_HUMAN | 28S ribosomal protein S9, mitochondrial OS=Homo sapiens GN=MRPS9 PE=1 SV=2 | 12 | 139 | 4.0E-09 |
sp|P44388|RS9_HAEIN | 30S ribosomal protein S9 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpsI PE=3 SV=2 | 12 | 144 | 5.0E-09 |
sp|A5UEV9|RS9_HAEIG | 30S ribosomal protein S9 OS=Haemophilus influenzae (strain PittGG) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-09 |
sp|A5UC54|RS9_HAEIE | 30S ribosomal protein S9 OS=Haemophilus influenzae (strain PittEE) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-09 |
sp|Q4QKG9|RS9_HAEI8 | 30S ribosomal protein S9 OS=Haemophilus influenzae (strain 86-028NP) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-09 |
sp|A4JBK5|RS9_BURVG | 30S ribosomal protein S9 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-09 |
sp|Q39JJ9|RS9_BURL3 | 30S ribosomal protein S9 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-09 |
sp|B4EET5|RS9_BURCJ | 30S ribosomal protein S9 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-09 |
sp|A0K4K6|RS9_BURCH | 30S ribosomal protein S9 OS=Burkholderia cenocepacia (strain HI2424) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-09 |
sp|B1JVU5|RS9_BURCC | 30S ribosomal protein S9 OS=Burkholderia cenocepacia (strain MC0-3) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-09 |
sp|Q1BZ44|RS9_BURCA | 30S ribosomal protein S9 OS=Burkholderia cenocepacia (strain AU 1054) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-09 |
sp|C5D3V1|RS9_GEOSW | 30S ribosomal protein S9 OS=Geobacillus sp. (strain WCH70) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-09 |
sp|A1JR92|RS9_YERE8 | 30S ribosomal protein S9 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-09 |
sp|B2UFK2|RS9_RALPJ | 30S ribosomal protein S9 OS=Ralstonia pickettii (strain 12J) GN=rpsI PE=3 SV=1 | 12 | 144 | 7.0E-09 |
sp|A6LPU7|RS9_CLOB8 | 30S ribosomal protein S9 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rpsI PE=3 SV=1 | 12 | 144 | 8.0E-09 |
sp|B8DB44|RS9_LISMH | 30S ribosomal protein S9 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-08 |
sp|Q71WI2|RS9_LISMF | 30S ribosomal protein S9 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-08 |
sp|C1KZ11|RS9_LISMC | 30S ribosomal protein S9 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-08 |
sp|Q927P3|RS9_LISIN | 30S ribosomal protein S9 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-08 |
sp|B8D7S5|RS9_BUCAT | 30S ribosomal protein S9 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-08 |
sp|Q8K9G0|RS9_BUCAP | 30S ribosomal protein S9 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-08 |
sp|A4FPH0|RS9_SACEN | 30S ribosomal protein S9 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=rpsI PE=3 SV=1 | 4 | 144 | 1.0E-08 |
sp|P57470|RS9_BUCAI | 30S ribosomal protein S9 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-08 |
sp|B8D9H3|RS9_BUCA5 | 30S ribosomal protein S9 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-08 |
sp|B1HMU8|RS9_LYSSC | 30S ribosomal protein S9 OS=Lysinibacillus sphaericus (strain C3-41) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-08 |
sp|A8GK02|RS9_SERP5 | 30S ribosomal protein S9 OS=Serratia proteamaculans (strain 568) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-08 |
sp|A1UT84|RS9_BARBK | 30S ribosomal protein S9 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-08 |
sp|A0ALT2|RS9_LISW6 | 30S ribosomal protein S9 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-08 |
sp|A8MLH6|RS9_ALKOO | 30S ribosomal protein S9 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-08 |
sp|C5CDI2|RS9_KOSOT | 30S ribosomal protein S9 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-08 |
sp|Q8Y459|RS9_LISMO | 30S ribosomal protein S9 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-08 |
sp|B3QKG4|RS9_RHOPT | 30S ribosomal protein S9 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-08 |
sp|Q6N650|RS9_RHOPA | 30S ribosomal protein S9 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpsI PE=1 SV=1 | 12 | 144 | 3.0E-08 |
sp|Q03MU5|RS9_STRTD | 30S ribosomal protein S9 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-08 |
sp|Q5M6E6|RS9_STRT2 | 30S ribosomal protein S9 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-08 |
sp|Q5M1V6|RS9_STRT1 | 30S ribosomal protein S9 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-08 |
sp|Q6F0X3|RS9_MESFL | 30S ribosomal protein S9 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-08 |
sp|C5CM23|RS9_VARPS | 30S ribosomal protein S9 OS=Variovorax paradoxus (strain S110) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-08 |
sp|Q220T1|RS9_RHOFT | 30S ribosomal protein S9 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-08 |
sp|Q7NRT4|RS9_CHRVO | 30S ribosomal protein S9 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rpsI PE=3 SV=1 | 12 | 93 | 4.0E-08 |
sp|Q6G3I7|RS9_BARHE | 30S ribosomal protein S9 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-08 |
sp|Q97EL3|RS9_CLOAB | 30S ribosomal protein S9 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-08 |
sp|A6SUN8|RS9_JANMA | 30S ribosomal protein S9 OS=Janthinobacterium sp. (strain Marseille) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-08 |
sp|A6TWE6|RS9_ALKMQ | 30S ribosomal protein S9 OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpsI PE=3 SV=1 | 12 | 144 | 5.0E-08 |
sp|Q18CJ5|RS9_PEPD6 | 30S ribosomal protein S9 OS=Peptoclostridium difficile (strain 630) GN=rpsI PE=3 SV=1 | 7 | 144 | 5.0E-08 |
sp|B2TIL1|RS9_CLOBB | 30S ribosomal protein S9 OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rpsI PE=3 SV=1 | 12 | 144 | 5.0E-08 |
sp|C1CC86|RS9_STRZJ | 30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain JJA) GN=rpsI PE=3 SV=1 | 12 | 144 | 5.0E-08 |
sp|Q8CWU4|RS9_STRR6 | 30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpsI PE=3 SV=1 | 12 | 144 | 5.0E-08 |
sp|B2ISM4|RS9_STRPS | 30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain CGSP14) GN=rpsI PE=3 SV=1 | 12 | 144 | 5.0E-08 |
sp|B1I922|RS9_STRPI | 30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpsI PE=3 SV=1 | 12 | 144 | 5.0E-08 |
sp|C1CB69|RS9_STRP7 | 30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain 70585) GN=rpsI PE=3 SV=1 | 12 | 144 | 5.0E-08 |
sp|B5E6W9|RS9_STRP4 | 30S ribosomal protein S9 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpsI PE=3 SV=1 | 12 | 144 | 5.0E-08 |
sp|Q04MF5|RS9_STRP2 | 30S ribosomal protein S9 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpsI PE=3 SV=1 | 12 | 144 | 5.0E-08 |
sp|Q3AQ24|RS9_CHLCH | 30S ribosomal protein S9 OS=Chlorobium chlorochromatii (strain CaD3) GN=rpsI PE=3 SV=1 | 6 | 144 | 6.0E-08 |
sp|Q07MN9|RS9_RHOP5 | 30S ribosomal protein S9 OS=Rhodopseudomonas palustris (strain BisA53) GN=rpsI PE=3 SV=1 | 12 | 144 | 6.0E-08 |
sp|B9KT42|RS9_RHOSK | 30S ribosomal protein S9 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rpsI PE=3 SV=1 | 12 | 144 | 7.0E-08 |
sp|Q3J1Z5|RS9_RHOS4 | 30S ribosomal protein S9 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpsI PE=3 SV=1 | 12 | 144 | 7.0E-08 |
sp|A3PK94|RS9_RHOS1 | 30S ribosomal protein S9 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpsI PE=3 SV=1 | 12 | 144 | 7.0E-08 |
sp|C1CPG8|RS9_STRZT | 30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpsI PE=3 SV=1 | 12 | 144 | 7.0E-08 |
sp|C1CIH6|RS9_STRZP | 30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain P1031) GN=rpsI PE=3 SV=1 | 12 | 144 | 7.0E-08 |
sp|Q97SN4|RS9_STRPN | 30S ribosomal protein S9 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpsI PE=3 SV=1 | 12 | 144 | 7.0E-08 |
sp|B8ZL30|RS9_STRPJ | 30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpsI PE=3 SV=1 | 12 | 144 | 7.0E-08 |
sp|Q8RGG8|RS9_FUSNN | 30S ribosomal protein S9 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rpsI PE=3 SV=1 | 12 | 144 | 7.0E-08 |
sp|A3DGC4|RS9_CLOTH | 30S ribosomal protein S9 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpsI PE=3 SV=1 | 12 | 144 | 7.0E-08 |
sp|Q124N7|RS9_POLSJ | 30S ribosomal protein S9 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rpsI PE=3 SV=1 | 12 | 144 | 8.0E-08 |
sp|Q136Q2|RS9_RHOPS | 30S ribosomal protein S9 OS=Rhodopseudomonas palustris (strain BisB5) GN=rpsI PE=3 SV=1 | 12 | 144 | 8.0E-08 |
sp|A8ER06|RS9_ARCB4 | 30S ribosomal protein S9 OS=Arcobacter butzleri (strain RM4018) GN=rpsI PE=3 SV=1 | 8 | 126 | 8.0E-08 |
sp|Q1MIP3|RS9_RHIL3 | 30S ribosomal protein S9 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpsI PE=3 SV=1 | 12 | 144 | 8.0E-08 |
sp|Q8NST5|RS9_CORGL | 30S ribosomal protein S9 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=rpsI PE=3 SV=1 | 8 | 144 | 8.0E-08 |
sp|A4QBS4|RS9_CORGB | 30S ribosomal protein S9 OS=Corynebacterium glutamicum (strain R) GN=rpsI PE=3 SV=1 | 8 | 144 | 8.0E-08 |
sp|B2S4R1|RS9_TREPS | 30S ribosomal protein S9 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rpsI PE=3 SV=1 | 12 | 144 | 9.0E-08 |
sp|O83987|RS9_TREPA | 30S ribosomal protein S9 OS=Treponema pallidum (strain Nichols) GN=rpsI PE=3 SV=1 | 12 | 144 | 9.0E-08 |
sp|Q03EE9|RS9_PEDPA | 30S ribosomal protein S9 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpsI PE=3 SV=1 | 12 | 144 | 9.0E-08 |
sp|B9E9M4|RS9_MACCJ | 30S ribosomal protein S9 OS=Macrococcus caseolyticus (strain JCSC5402) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-07 |
sp|B3PVW3|RS9_RHIE6 | 30S ribosomal protein S9 OS=Rhizobium etli (strain CIAT 652) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-07 |
sp|B5ZXZ5|RS9_RHILW | 30S ribosomal protein S9 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-07 |
sp|B2A4Q7|RS9_NATTJ | 30S ribosomal protein S9 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rpsI PE=3 SV=1 | 4 | 144 | 1.0E-07 |
sp|B4SEC8|RS9_PELPB | 30S ribosomal protein S9 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=rpsI PE=3 SV=1 | 6 | 144 | 1.0E-07 |
sp|B9MLF6|RS9_CALBD | 30S ribosomal protein S9 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-07 |
sp|A1TUF5|RS9_ACIAC | 30S ribosomal protein S9 OS=Acidovorax citrulli (strain AAC00-1) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-07 |
sp|P31177|RS9_STACT | 30S ribosomal protein S9 OS=Staphylococcus carnosus (strain TM300) GN=rpsI PE=3 SV=2 | 12 | 144 | 1.0E-07 |
sp|A8Z324|RS9_STAAT | 30S ribosomal protein S9 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rpsI PE=3 SV=1 | 1 | 144 | 1.0E-07 |
sp|Q5HDZ1|RS9_STAAC | 30S ribosomal protein S9 OS=Staphylococcus aureus (strain COL) GN=rpsI PE=3 SV=1 | 1 | 144 | 1.0E-07 |
sp|Q2YYM9|RS9_STAAB | 30S ribosomal protein S9 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpsI PE=3 SV=1 | 1 | 144 | 1.0E-07 |
sp|Q2FW39|RS9_STAA8 | 30S ribosomal protein S9 OS=Staphylococcus aureus (strain NCTC 8325) GN=rpsI PE=3 SV=1 | 1 | 144 | 1.0E-07 |
sp|Q2FES2|RS9_STAA3 | 30S ribosomal protein S9 OS=Staphylococcus aureus (strain USA300) GN=rpsI PE=3 SV=1 | 1 | 144 | 1.0E-07 |
sp|A5N4T2|RS9_CLOK5 | 30S ribosomal protein S9 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpsI PE=3 SV=1 | 8 | 144 | 1.0E-07 |
sp|B9DYE4|RS9_CLOK1 | 30S ribosomal protein S9 OS=Clostridium kluyveri (strain NBRC 12016) GN=rpsI PE=3 SV=1 | 8 | 144 | 1.0E-07 |
sp|A4XJ60|RS9_CALS8 | 30S ribosomal protein S9 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpsI PE=3 SV=2 | 12 | 144 | 1.0E-07 |
sp|Q7NBH4|RS9_MYCGA | 30S ribosomal protein S9 OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=rpsI PE=3 SV=2 | 4 | 136 | 1.0E-07 |
sp|A4G1T3|RS9_HERAR | 30S ribosomal protein S9 OS=Herminiimonas arsenicoxydans GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-07 |
sp|Q9HVY3|RS9_PSEAE | 30S ribosomal protein S9 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rpsI PE=3 SV=1 | 3 | 144 | 2.0E-07 |
sp|Q02H08|RS9_PSEAB | 30S ribosomal protein S9 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rpsI PE=3 SV=1 | 3 | 144 | 2.0E-07 |
sp|B7UZL0|RS9_PSEA8 | 30S ribosomal protein S9 OS=Pseudomonas aeruginosa (strain LESB58) GN=rpsI PE=3 SV=1 | 3 | 144 | 2.0E-07 |
sp|A1QZD0|RS9_BORT9 | 30S ribosomal protein S9 OS=Borrelia turicatae (strain 91E135) GN=rpsI PE=3 SV=1 | 12 | 126 | 2.0E-07 |
sp|Q2IWN6|RS9_RHOP2 | 30S ribosomal protein S9 OS=Rhodopseudomonas palustris (strain HaA2) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-07 |
sp|B1Y3K6|RS9_LEPCP | 30S ribosomal protein S9 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-07 |
sp|Q8DW97|RS9_STRMU | 30S ribosomal protein S9 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-07 |
sp|A5EKC6|RS9_BRASB | 30S ribosomal protein S9 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-07 |
sp|Q5Z1H9|RS9_NOCFA | 30S ribosomal protein S9 OS=Nocardia farcinica (strain IFM 10152) GN=rpsI PE=3 SV=1 | 6 | 144 | 2.0E-07 |
sp|Q60AF7|RS9_METCA | 30S ribosomal protein S9 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-07 |
sp|Q1QKK3|RS9_NITHX | 30S ribosomal protein S9 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-07 |
sp|B4U561|RS9_STREM | 30S ribosomal protein S9 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-07 |
sp|C0M903|RS9_STRE4 | 30S ribosomal protein S9 OS=Streptococcus equi subsp. equi (strain 4047) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-07 |
sp|A9C178|RS9_DELAS | 30S ribosomal protein S9 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-07 |
sp|C0MFN0|RS9_STRS7 | 30S ribosomal protein S9 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-07 |
sp|Q53875|RS9_STRCO | 30S ribosomal protein S9 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rpsI PE=3 SV=1 | 1 | 144 | 2.0E-07 |
sp|Q0BZT3|RS9_HYPNA | 30S ribosomal protein S9 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-07 |
sp|A1VJJ4|RS9_POLNA | 30S ribosomal protein S9 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-07 |
sp|A6VBA5|RS9_PSEA7 | 30S ribosomal protein S9 OS=Pseudomonas aeruginosa (strain PA7) GN=rpsI PE=3 SV=1 | 3 | 144 | 2.0E-07 |
sp|B1YH85|RS9_EXIS2 | 30S ribosomal protein S9 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rpsI PE=3 SV=1 | 12 | 144 | 2.0E-07 |
sp|P66647|RS9_STAAW | 30S ribosomal protein S9 OS=Staphylococcus aureus (strain MW2) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-07 |
sp|Q6G7A4|RS9_STAAS | 30S ribosomal protein S9 OS=Staphylococcus aureus (strain MSSA476) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-07 |
sp|Q6GEL8|RS9_STAAR | 30S ribosomal protein S9 OS=Staphylococcus aureus (strain MRSA252) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-07 |
sp|P66646|RS9_STAAN | 30S ribosomal protein S9 OS=Staphylococcus aureus (strain N315) GN=rpsI PE=1 SV=1 | 12 | 144 | 3.0E-07 |
sp|P66645|RS9_STAAM | 30S ribosomal protein S9 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-07 |
sp|A6QJ59|RS9_STAAE | 30S ribosomal protein S9 OS=Staphylococcus aureus (strain Newman) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-07 |
sp|A5IV01|RS9_STAA9 | 30S ribosomal protein S9 OS=Staphylococcus aureus (strain JH9) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-07 |
sp|A6U3U2|RS9_STAA2 | 30S ribosomal protein S9 OS=Staphylococcus aureus (strain JH1) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-07 |
sp|A7X5B3|RS9_STAA1 | 30S ribosomal protein S9 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-07 |
sp|B3EU85|RS9_AMOA5 | 30S ribosomal protein S9 OS=Amoebophilus asiaticus (strain 5a2) GN=rpsI PE=3 SV=1 | 8 | 144 | 3.0E-07 |
sp|C4KZL2|RS9_EXISA | 30S ribosomal protein S9 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-07 |
sp|A8F8P5|RS9_PSELT | 30S ribosomal protein S9 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rpsI PE=3 SV=1 | 11 | 144 | 3.0E-07 |
sp|Q02VM1|RS9_LACLS | 30S ribosomal protein S9 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-07 |
sp|A2RP61|RS9_LACLM | 30S ribosomal protein S9 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-07 |
sp|Q9CDG7|RS9_LACLA | 30S ribosomal protein S9 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rpsI PE=3 SV=1 | 12 | 144 | 3.0E-07 |
sp|Q3A9V2|RS9_CARHZ | 30S ribosomal protein S9 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-07 |
sp|B1VA58|RS9_PHYAS | 30S ribosomal protein S9 OS=Phytoplasma australiense GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-07 |
sp|C3LS61|RS9_VIBCM | 30S ribosomal protein S9 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-07 |
sp|Q9KUF0|RS9_VIBCH | 30S ribosomal protein S9 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-07 |
sp|A5F998|RS9_VIBC3 | 30S ribosomal protein S9 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpsI PE=3 SV=1 | 12 | 144 | 4.0E-07 |
sp|A0PMD2|RS9_MYCUA | 30S ribosomal protein S9 OS=Mycobacterium ulcerans (strain Agy99) GN=rpsI PE=3 SV=1 | 6 | 144 | 4.0E-07 |
sp|B2HCZ1|RS9_MYCMM | 30S ribosomal protein S9 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=rpsI PE=3 SV=1 | 6 | 144 | 4.0E-07 |
sp|A4SDC0|RS9_CHLPM | 30S ribosomal protein S9 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rpsI PE=3 SV=1 | 6 | 144 | 4.0E-07 |
sp|Q1BCZ0|RS9_MYCSS | 30S ribosomal protein S9 OS=Mycobacterium sp. (strain MCS) GN=rpsI PE=3 SV=1 | 6 | 144 | 4.0E-07 |
sp|A1UC03|RS9_MYCSK | 30S ribosomal protein S9 OS=Mycobacterium sp. (strain KMS) GN=rpsI PE=3 SV=1 | 6 | 144 | 4.0E-07 |
sp|A3PVN4|RS9_MYCSJ | 30S ribosomal protein S9 OS=Mycobacterium sp. (strain JLS) GN=rpsI PE=3 SV=1 | 6 | 144 | 4.0E-07 |
sp|Q890R7|RS9_CLOTE | 30S ribosomal protein S9 OS=Clostridium tetani (strain Massachusetts / E88) GN=rpsI PE=3 SV=1 | 12 | 144 | 5.0E-07 |
sp|B1W3X4|RS9_STRGG | 30S ribosomal protein S9 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=rpsI PE=3 SV=1 | 6 | 144 | 5.0E-07 |
sp|Q7V520|RS9_PROMM | 30S ribosomal protein S9 OS=Prochlorococcus marinus (strain MIT 9313) GN=rpsI PE=3 SV=1 | 1 | 90 | 5.0E-07 |
sp|A8I7Z9|RS9_AZOC5 | 30S ribosomal protein S9 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpsI PE=3 SV=1 | 12 | 144 | 5.0E-07 |
sp|Q3SSQ8|RS9_NITWN | 30S ribosomal protein S9 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpsI PE=3 SV=1 | 12 | 144 | 5.0E-07 |
sp|Q6B8X6|RR9_GRATL | 30S ribosomal protein S9, chloroplastic OS=Gracilaria tenuistipitata var. liui GN=rps9 PE=3 SV=1 | 1 | 144 | 5.0E-07 |
sp|B6JGT6|RS9_OLICO | 30S ribosomal protein S9 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rpsI PE=3 SV=1 | 12 | 144 | 5.0E-07 |
sp|A0QSP9|RS9_MYCS2 | 30S ribosomal protein S9 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rpsI PE=1 SV=1 | 6 | 144 | 5.0E-07 |
sp|A2CC55|RS9_PROM3 | 30S ribosomal protein S9 OS=Prochlorococcus marinus (strain MIT 9303) GN=rpsI PE=3 SV=1 | 1 | 90 | 6.0E-07 |
sp|Q58DQ5|RT09_BOVIN | 28S ribosomal protein S9, mitochondrial OS=Bos taurus GN=MRPS9 PE=1 SV=3 | 12 | 139 | 6.0E-07 |
sp|P40828|RS9_MYCLE | 30S ribosomal protein S9 OS=Mycobacterium leprae (strain TN) GN=rpsI PE=3 SV=1 | 6 | 144 | 7.0E-07 |
sp|B8ZUC0|RS9_MYCLB | 30S ribosomal protein S9 OS=Mycobacterium leprae (strain Br4923) GN=rpsI PE=3 SV=1 | 6 | 144 | 7.0E-07 |
sp|B2S045|RS9_BORHD | 30S ribosomal protein S9 OS=Borrelia hermsii (strain HS1 / DAH) GN=rpsI PE=3 SV=1 | 12 | 126 | 7.0E-07 |
sp|Q65P72|RS9_BACLD | 30S ribosomal protein S9 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpsI PE=3 SV=1 | 8 | 144 | 7.0E-07 |
sp|B8I816|RS9_CLOCE | 30S ribosomal protein S9 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=rpsI PE=3 SV=1 | 12 | 144 | 8.0E-07 |
sp|A5FRV9|RS9_DEHMB | 30S ribosomal protein S9 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rpsI PE=3 SV=1 | 12 | 143 | 8.0E-07 |
sp|A1WL75|RS9_VEREI | 30S ribosomal protein S9 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rpsI PE=3 SV=1 | 12 | 144 | 8.0E-07 |
sp|Q8KBK5|RS9_CHLTE | 30S ribosomal protein S9 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rpsI PE=3 SV=1 | 6 | 126 | 9.0E-07 |
sp|A8F9B9|RS9_BACP2 | 30S ribosomal protein S9 OS=Bacillus pumilus (strain SAFR-032) GN=rpsI PE=3 SV=1 | 12 | 144 | 9.0E-07 |
sp|Q6AD27|RS9_LEIXX | 30S ribosomal protein S9 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=rpsI PE=3 SV=1 | 10 | 144 | 9.0E-07 |
sp|Q4L880|RS9_STAHJ | 30S ribosomal protein S9 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpsI PE=3 SV=1 | 12 | 144 | 9.0E-07 |
sp|B2FJU3|RS9_STRMK | 30S ribosomal protein S9 OS=Stenotrophomonas maltophilia (strain K279a) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-06 |
sp|B4SLE0|RS9_STRM5 | 30S ribosomal protein S9 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-06 |
sp|Q3ZZP2|RS9_DEHMC | 30S ribosomal protein S9 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rpsI PE=3 SV=1 | 12 | 143 | 1.0E-06 |
sp|Q8CRJ0|RS9_STAES | 30S ribosomal protein S9 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-06 |
sp|Q5HM32|RS9_STAEQ | 30S ribosomal protein S9 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-06 |
sp|Q49ZD5|RS9_STAS1 | 30S ribosomal protein S9 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-06 |
sp|Q82DL8|RS9_STRAW | 30S ribosomal protein S9 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rpsI PE=3 SV=1 | 6 | 144 | 1.0E-06 |
sp|Q9MUV1|RR9_MESVI | 30S ribosomal protein S9, chloroplastic OS=Mesostigma viride GN=rps9 PE=3 SV=1 | 12 | 144 | 1.0E-06 |
sp|Q8EWW8|RS9_MYCPE | 30S ribosomal protein S9 OS=Mycoplasma penetrans (strain HF-2) GN=rpsI PE=3 SV=1 | 7 | 144 | 1.0E-06 |
sp|Q8E1Y6|RS9_STRA5 | 30S ribosomal protein S9 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-06 |
sp|Q8E7E4|RS9_STRA3 | 30S ribosomal protein S9 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpsI PE=3 SV=1 | 12 | 144 | 1.0E-06 |
GO Term | Description | Terminal node |
---|---|---|
GO:0003735 | structural constituent of ribosome | Yes |
GO:0006412 | translation | Yes |
GO:0005840 | ribosome | Yes |
GO:0043043 | peptide biosynthetic process | No |
GO:0043226 | organelle | No |
GO:0043229 | intracellular organelle | No |
GO:0043170 | macromolecule metabolic process | No |
GO:1901576 | organic substance biosynthetic process | No |
GO:0044271 | cellular nitrogen compound biosynthetic process | No |
GO:0044260 | cellular macromolecule metabolic process | No |
GO:0019538 | protein metabolic process | No |
GO:0006518 | peptide metabolic process | No |
GO:0008152 | metabolic process | No |
GO:0009058 | biosynthetic process | No |
GO:0009987 | cellular process | No |
GO:0005198 | structural molecule activity | No |
GO:0044238 | primary metabolic process | No |
GO:0044237 | cellular metabolic process | No |
GO:0043232 | intracellular non-membrane-bounded organelle | No |
GO:0006807 | nitrogen compound metabolic process | No |
GO:0110165 | cellular anatomical entity | No |
GO:0043228 | non-membrane-bounded organelle | No |
GO:0005575 | cellular_component | No |
GO:0044249 | cellular biosynthetic process | No |
GO:0003674 | molecular_function | No |
GO:0034641 | cellular nitrogen compound metabolic process | No |
GO:1901564 | organonitrogen compound metabolic process | No |
GO:1901566 | organonitrogen compound biosynthetic process | No |
GO:0008150 | biological_process | No |
GO:0009059 | macromolecule biosynthetic process | No |
GO:0071704 | organic substance metabolic process | No |
GO:0034645 | cellular macromolecule biosynthetic process | No |
GO:0043604 | amide biosynthetic process | No |
GO:0043603 | cellular amide metabolic process | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 20 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Ophun1|2354 MSSATQSVQCFGKKKTATAVAHCKAGRGLIKVNGRPLQLVQPEILRFKVYEPLLVVGLDKFANVDIRVRVTGGGH TSQIYAIRQAIAKALIAYYQKYVDEHSKNMLKQALVQFDRTLLVADNRRCEPKKFGGPGARARYQKSYR* |
Coding | >Ophun1|2354 ATGTCGTCGGCTACGCAGAGCGTGCAATGCTTCGGCAAGAAGAAGACTGCCACGGCCGTCGCTCACTGCAAGGCT GGTCGTGGACTCATCAAAGTCAACGGACGACCTCTTCAGCTGGTGCAGCCCGAAATCCTGCGCTTCAAGGTGTAC GAACCGCTGCTGGTGGTCGGGCTGGATAAATTCGCAAACGTCGACATCAGAGTGCGCGTCACGGGCGGAGGCCAC ACGTCGCAAATCTACGCCATCCGACAGGCCATCGCCAAGGCGCTCATCGCCTACTACCAAAAGTACGTCGACGAG CATTCCAAGAACATGCTCAAGCAGGCGCTCGTCCAGTTCGATCGCACCCTGCTCGTTGCCGATAATCGGCGCTGC GAGCCCAAGAAGTTTGGTGGGCCGGGTGCTAGGGCTCGTTACCAGAAGTCGTACCGATAG |
Transcript | >Ophun1|2354 ATGTCGTCGGCTACGCAGAGCGTGCAATGCTTCGGCAAGAAGAAGACTGCCACGGCCGTCGCTCACTGCAAGGCT GGTCGTGGACTCATCAAAGTCAACGGACGACCTCTTCAGCTGGTGCAGCCCGAAATCCTGCGCTTCAAGGTGTAC GAACCGCTGCTGGTGGTCGGGCTGGATAAATTCGCAAACGTCGACATCAGAGTGCGCGTCACGGGCGGAGGCCAC ACGTCGCAAATCTACGCCATCCGACAGGCCATCGCCAAGGCGCTCATCGCCTACTACCAAAAGTACGTCGACGAG CATTCCAAGAACATGCTCAAGCAGGCGCTCGTCCAGTTCGATCGCACCCTGCTCGTTGCCGATAATCGGCGCTGC GAGCCCAAGAAGTTTGGTGGGCCGGGTGCTAGGGCTCGTTACCAGAAGTCGTACCGATAG |
Gene | >Ophun1|2354 ATGTCGTCGGCTACGCAGAGCGTGCAATGCTTCGGCAAGAAGAAGACTGCCACGGCCGTCGCTCACTGCAAGGTG AGTTCTCTTTTTTCCTCATTTCTAAAGAGGATGGAGAGCTGATTTGCGTGGCAGGCTGGTCGTGGACTCATCAAA GTCAACGGACGACCTCTTCAGCTGGTGCAGCCCGAAATCCTGCGCTTCAAGGTTGCTTTCCCTCGTCCTCTTATA CGCAGGGATGATGTCAGGAAGCTAACGGGGGGGGGGATAGGTGTACGAACCGCTGCTGGTGGTCGGGCTGGATAA ATTCGCAAACGTCGACATCAGAGTGCGCGTCACGGGCGGAGGCCACACGTCGCAAATCTACGCCATCCGACAGGC CATCGCCAAGGCGCTCATCGCCTACTACCAAAAGTACGTCGACGAGCATTCCAAGAACATGCTCAAGCAGGCGCT CGTCCAGTTCGATCGCACCCTGCTCGTTGCCGATAATCGGCGCTGCGAGCCCAAGAAGTTTGGTGGGCCGGGTGC TAGGGCTCGTTACCAGAAGTCGTACCGATAG |