Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2349
Gene name
LocationContig_214:20770..22656
Strand-
Gene length (bp)1886
Transcript length (bp)1770
Coding sequence length (bp)1770
Protein length (aa) 590

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup515
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7433
Ophiocordyceps australis map64 (Brazil) OphauB2|1555
Ophiocordyceps australis map64 (Brazil) OphauB2|595
Ophiocordyceps camponoti-floridani Ophcf2|06721
Ophiocordyceps camponoti-floridani Ophcf2|07183
Ophiocordyceps camponoti-rufipedis Ophun1|2349 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|462
Ophiocordyceps kimflemingae Ophio5|3679
Ophiocordyceps subramaniannii Hirsu2|226

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2349
MPLSEDHPRYLFFITDGDPDFFRSAGGIVPLLTWDQRDNSWGFMTFGREGGPWVPLDDRYTADMRPYRELRSWIY
EVSTSPHIVAGTTHTCCGRHYWALGGVYWSQVRRYGFREQVGTISMISWTYNPAYDSRWDRYSACDFQPQLAGFD
RYNRAWGRRDGFTRRERPPRGMTRRDLAELHMNLITRRDPLLTRMLRWQGHFPLINQRNPSLTIRMGWQNIQALP
VEQISWWDLEIPQRARDTIRSWRLSNEQCYSIINSIVATNWLYTLKINSRAQQKRSLPDPDEDSCSDPEPEPFPP
ESECHDLTPALRQLRSLNAMCSTFTRLEFYLEVATDLFAGTWDVLYVQLGGATRSIEVNGNISPGEKGWYKLNMQ
TMYGREAVQVDDINSIAILERIGNKLIGGDEWKLKGVKLQGTCQDDLTTYEMGKYAAVNQLVHMQHRLTWPWSKQ
QLVWNRTIDPSDWQEVVSCPYFDRLTVHVSLGFWDDPDDIFIQIGREQYNIVQSPFDVNLSKSFGPDEYTDSQSK
VLIPDIQNFTIFYGPRARASAYPSDGLTLKGRTAPKISLSTALPYSPHAKASNWSQDAPAQANE*
Coding >Ophun1|2349
ATGCCCCTAAGCGAGGACCACCCCCGATACCTCTTCTTCATCACCGACGGGGACCCCGACTTCTTCCGCTCAGCC
GGGGGCATCGTCCCTCTCCTCACCTGGGACCAGCGCGATAACTCCTGGGGCTTCATGACGTTCGGACGCGAGGGA
GGCCCCTGGGTTCCCCTCGACGACAGATACACGGCCGACATGCGACCATACCGAGAACTCCGCTCATGGATCTAC
GAGGTCTCTACCTCTCCCCACATCGTGGCCGGCACTACACACACATGCTGCGGCAGGCATTATTGGGCCCTGGGC
GGCGTCTACTGGTCTCAAGTCCGCAGATACGGCTTCAGAGAACAGGTAGGCACCATCTCCATGATTTCCTGGACC
TATAACCCGGCCTACGACTCTAGATGGGATCGTTACTCGGCCTGTGACTTCCAGCCACAGCTCGCCGGCTTCGAT
CGCTATAATCGAGCCTGGGGCCGTCGCGATGGCTTCACGAGGAGGGAACGGCCGCCACGGGGCATGACGCGCCGA
GATCTGGCAGAGCTTCACATGAACCTCATCACGCGAAGAGACCCGTTACTCACAAGGATGCTGCGCTGGCAGGGA
CATTTCCCCTTGATCAATCAGCGGAATCCATCCCTGACCATCAGAATGGGCTGGCAGAATATCCAAGCGCTCCCG
GTAGAGCAAATCTCCTGGTGGGACCTGGAGATCCCGCAACGGGCACGAGACACGATTCGGTCCTGGCGGCTCAGC
AATGAGCAATGCTACAGCATCATCAACTCCATAGTGGCAACCAACTGGCTCTACACGCTAAAGATCAACAGCAGA
GCCCAGCAAAAGCGCTCACTCCCAGATCCAGACGAGGACTCCTGCTCCGATCCAGAACCAGAGCCCTTCCCCCCC
GAATCCGAATGCCACGACCTCACCCCCGCCCTCAGGCAACTCCGAAGCCTCAACGCCATGTGCAGCACCTTCACC
CGCCTCGAATTCTACCTCGAAGTAGCAACCGACCTCTTCGCCGGAACCTGGGACGTCCTCTACGTCCAACTCGGC
GGCGCAACCCGCAGCATCGAAGTCAACGGCAACATCTCCCCCGGCGAGAAAGGCTGGTACAAGCTCAACATGCAA
ACCATGTACGGCCGCGAAGCCGTCCAAGTCGACGACATCAACTCCATCGCCATCCTCGAACGCATCGGCAACAAG
CTCATAGGCGGCGACGAGTGGAAACTAAAAGGCGTCAAGCTCCAAGGCACATGTCAAGACGACCTCACAACCTAC
GAGATGGGAAAGTACGCCGCCGTCAACCAGCTCGTCCACATGCAGCACCGCTTAACCTGGCCCTGGTCCAAGCAG
CAACTCGTCTGGAACCGCACCATCGACCCATCCGACTGGCAAGAGGTCGTCTCCTGTCCCTACTTCGACCGTCTG
ACCGTCCACGTCTCCCTCGGATTCTGGGACGACCCCGACGACATCTTCATCCAAATCGGTAGAGAGCAGTACAAT
ATCGTCCAATCACCCTTTGACGTCAACTTGTCCAAGTCATTCGGTCCCGACGAATACACCGACTCTCAAAGCAAA
GTCTTGATCCCCGATATCCAAAACTTCACCATCTTCTACGGTCCCCGTGCCCGCGCGTCAGCGTATCCGTCAGAC
GGCCTCACATTAAAAGGTAGAACCGCTCCCAAAATCTCCCTTTCTACGGCCCTACCATACTCACCACATGCAAAG
GCATCGAACTGGTCGCAAGATGCGCCGGCTCAGGCCAACGAGTAG
Transcript >Ophun1|2349
ATGCCCCTAAGCGAGGACCACCCCCGATACCTCTTCTTCATCACCGACGGGGACCCCGACTTCTTCCGCTCAGCC
GGGGGCATCGTCCCTCTCCTCACCTGGGACCAGCGCGATAACTCCTGGGGCTTCATGACGTTCGGACGCGAGGGA
GGCCCCTGGGTTCCCCTCGACGACAGATACACGGCCGACATGCGACCATACCGAGAACTCCGCTCATGGATCTAC
GAGGTCTCTACCTCTCCCCACATCGTGGCCGGCACTACACACACATGCTGCGGCAGGCATTATTGGGCCCTGGGC
GGCGTCTACTGGTCTCAAGTCCGCAGATACGGCTTCAGAGAACAGGTAGGCACCATCTCCATGATTTCCTGGACC
TATAACCCGGCCTACGACTCTAGATGGGATCGTTACTCGGCCTGTGACTTCCAGCCACAGCTCGCCGGCTTCGAT
CGCTATAATCGAGCCTGGGGCCGTCGCGATGGCTTCACGAGGAGGGAACGGCCGCCACGGGGCATGACGCGCCGA
GATCTGGCAGAGCTTCACATGAACCTCATCACGCGAAGAGACCCGTTACTCACAAGGATGCTGCGCTGGCAGGGA
CATTTCCCCTTGATCAATCAGCGGAATCCATCCCTGACCATCAGAATGGGCTGGCAGAATATCCAAGCGCTCCCG
GTAGAGCAAATCTCCTGGTGGGACCTGGAGATCCCGCAACGGGCACGAGACACGATTCGGTCCTGGCGGCTCAGC
AATGAGCAATGCTACAGCATCATCAACTCCATAGTGGCAACCAACTGGCTCTACACGCTAAAGATCAACAGCAGA
GCCCAGCAAAAGCGCTCACTCCCAGATCCAGACGAGGACTCCTGCTCCGATCCAGAACCAGAGCCCTTCCCCCCC
GAATCCGAATGCCACGACCTCACCCCCGCCCTCAGGCAACTCCGAAGCCTCAACGCCATGTGCAGCACCTTCACC
CGCCTCGAATTCTACCTCGAAGTAGCAACCGACCTCTTCGCCGGAACCTGGGACGTCCTCTACGTCCAACTCGGC
GGCGCAACCCGCAGCATCGAAGTCAACGGCAACATCTCCCCCGGCGAGAAAGGCTGGTACAAGCTCAACATGCAA
ACCATGTACGGCCGCGAAGCCGTCCAAGTCGACGACATCAACTCCATCGCCATCCTCGAACGCATCGGCAACAAG
CTCATAGGCGGCGACGAGTGGAAACTAAAAGGCGTCAAGCTCCAAGGCACATGTCAAGACGACCTCACAACCTAC
GAGATGGGAAAGTACGCCGCCGTCAACCAGCTCGTCCACATGCAGCACCGCTTAACCTGGCCCTGGTCCAAGCAG
CAACTCGTCTGGAACCGCACCATCGACCCATCCGACTGGCAAGAGGTCGTCTCCTGTCCCTACTTCGACCGTCTG
ACCGTCCACGTCTCCCTCGGATTCTGGGACGACCCCGACGACATCTTCATCCAAATCGGTAGAGAGCAGTACAAT
ATCGTCCAATCACCCTTTGACGTCAACTTGTCCAAGTCATTCGGTCCCGACGAATACACCGACTCTCAAAGCAAA
GTCTTGATCCCCGATATCCAAAACTTCACCATCTTCTACGGTCCCCGTGCCCGCGCGTCAGCGTATCCGTCAGAC
GGCCTCACATTAAAAGGTAGAACCGCTCCCAAAATCTCCCTTTCTACGGCCCTACCATACTCACCACATGCAAAG
GCATCGAACTGGTCGCAAGATGCGCCGGCTCAGGCCAACGAGTAG
Gene >Ophun1|2349
ATGCCCCTAAGCGAGGACCACCCCCGATACCTCTTCTTCATCACCGACGGGGACCCCGACTTCTTCCGCTCAGCC
GGGGGCATCGTCCCTCTCCTCACCTGGGACCAGCGCGATAACTCCTGGGGCTTCATGACGTTCGGACGCGAGGGA
GGCCCCTGGGTTCCCCTCGACGACAGATACACGGCCGACATGCGACCATACCGAGAACTCCGCTCATGGATCTAC
GAGGTCTCTACCTCTCCCCACATCGTGGCCGGCACTACACACACATGCTGCGGCAGGCATTATTGGGCCCTGGGC
GGCGTCTACTGGTCTCAAGTCCGCAGATACGGCTTCAGAGAACAGGTAGGCACCATCTCCATGATTTCCTGGACC
TATAACCCGGCCTACGACTCTAGATGGGATCGTTACTCGGCCTGTGACTTCCAGCCACAGCTCGCCGGCTTCGAT
CGCTATAATCGAGCCTGGGGCCGTCGCGATGGCTTCACGAGGAGGGAACGGCCGCCACGGGGCATGACGCGCCGA
GATCTGGCAGAGCTTCACATGAACCTCATCACGCGAAGAGACCCGTTACTCACAAGGATGCTGCGCTGGCAGGGA
CATTTCCCCTTGATCAATCAGCGGAATCCATCCCTGACCATCAGAATGGGCTGGCAGAATATCCAAGCGCTCCCG
GTAGAGCAAATCTCCTGGTGGGACCTGGAGATCCCGCAACGGGCACGAGACACGATTCGGTCCTGGCGGCTCAGC
AATGAGCAATGCTACAGCATCATCAACTCCATAGTGGCAACCAACTGGCTCTACACGCTAAAGATCAACAGCAGA
GCCCAGCAAAAGCGCTCACTCCCAGATCCAGACGAGGGTATGACCTACTCTTCAACCACGATATGACGACCTGAC
GAAATCAAGACTCCTGCTCCGATCCAGAACCAGAGCCCTTCCCCCCCGAATCCGAATGCCACGACCTCACCCCCG
CCCTCAGGCAACTCCGAAGCCTCAACGCCATGTGCAGCACCTTCACCCGCCTCGAATTCTACCTCGAAGTAGCAA
CCGACCTCTTCGCCGGAACCTGGGACGTCCTCTACGTCCAACTCGGCGGCGCAACCCGCAGCATCGAAGTCAACG
GCAACATCTCCCCCGGCGAGAAAGGCTGGTACAAGCTCAACATGCAAACCATGTACGGCCGCGAAGCCGTCCAAG
TCGACGACATCAACTCCATCGCCATCCTCGAACGCATCGGCAACAAGCTCATAGGCGGCGACGAGTGGAAACTAA
AAGGTCCCCTTCGTCCACACCATCCTCTCCCTTGAGATCCATAGAATTCTGACCCTGTCTCTTCCGAGCTAGGCG
TCAAGCTCCAAGGCACATGTCAAGACGACCTCACAACCTACGAGATGGGAAAGTACGCCGCCGTCAACCAGCTCG
TCCACATGCAGCACCGCTTAACCTGGCCCTGGTCCAAGCAGCAACTCGTCTGGAACCGCACCATCGACCCATCCG
ACTGGCAAGAGGTCGTCTCCTGTCCCTACTTCGACCGTCTGACCGTCCACGTCTCCCTCGGATTCTGGGACGACC
CCGACGACATCTTCATCCAAATCGGTAGAGAGCAGTACAATATCGTCCAATCACCCTTTGACGTCAACTTGTCCA
AGTCATTCGGTCCCGACGAATACACCGACTCTCAAAGCAAAGTCTTGATCCCCGATATCCAAAACTTCACCATCT
TCTACGGTCCCCGTGCCCGCGCGTCAGCGTATCCGTCAGACGGCCTCACATTAAAAGGTAGAACCGCTCCCAAAA
TCTCCCTTTCTACGGCCCTACCATACTCACCACATGCAAAGGCATCGAACTGGTCGCAAGATGCGCCGGCTCAGG
CCAACGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail