Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2341
Gene name
LocationContig_214:4242..4952
Strand-
Gene length (bp)710
Transcript length (bp)594
Coding sequence length (bp)594
Protein length (aa) 198

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.1E-07 29 100
PF13893 RRM_5 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.7E-06 17 121

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54J05|RU2B_DICDI U2 small nuclear ribonucleoprotein B'' OS=Dictyostelium discoideum GN=snrpb2 PE=3 SV=1 24 119 3.0E-31
sp|Q9CQI7|RU2B_MOUSE U2 small nuclear ribonucleoprotein B'' OS=Mus musculus GN=Snrpb2 PE=1 SV=1 25 119 3.0E-28
sp|P08579|RU2B_HUMAN U2 small nuclear ribonucleoprotein B'' OS=Homo sapiens GN=SNRPB2 PE=1 SV=1 25 119 3.0E-28
sp|Q7LL14|RU2B_SCHPO Probable U2 small nuclear ribonucleoprotein B'' OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msl1 PE=1 SV=1 28 115 3.0E-24
sp|Q8H1S6|RU2B2_ARATH U2 small nuclear ribonucleoprotein B'' 2 OS=Arabidopsis thaliana GN=At1g06960 PE=1 SV=1 23 119 7.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54J05|RU2B_DICDI U2 small nuclear ribonucleoprotein B'' OS=Dictyostelium discoideum GN=snrpb2 PE=3 SV=1 24 119 3.0E-31
sp|Q9CQI7|RU2B_MOUSE U2 small nuclear ribonucleoprotein B'' OS=Mus musculus GN=Snrpb2 PE=1 SV=1 25 119 3.0E-28
sp|P08579|RU2B_HUMAN U2 small nuclear ribonucleoprotein B'' OS=Homo sapiens GN=SNRPB2 PE=1 SV=1 25 119 3.0E-28
sp|Q7LL14|RU2B_SCHPO Probable U2 small nuclear ribonucleoprotein B'' OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msl1 PE=1 SV=1 28 115 3.0E-24
sp|Q8H1S6|RU2B2_ARATH U2 small nuclear ribonucleoprotein B'' 2 OS=Arabidopsis thaliana GN=At1g06960 PE=1 SV=1 23 119 7.0E-24
sp|Q06AA4|SNRPA_PIG U1 small nuclear ribonucleoprotein A OS=Sus scrofa GN=SNRPA PE=1 SV=1 20 119 8.0E-24
sp|Q2KIR1|SNRPA_BOVIN U1 small nuclear ribonucleoprotein A OS=Bos taurus GN=SNRPA PE=2 SV=1 20 119 9.0E-24
sp|P09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A OS=Homo sapiens GN=SNRPA PE=1 SV=3 20 119 9.0E-24
sp|O22922|RU2B1_ARATH U2 small nuclear ribonucleoprotein B'' OS=Arabidopsis thaliana GN=U2B'' PE=1 SV=1 24 119 8.0E-23
sp|P45429|SNRPA_XENLA U1 small nuclear ribonucleoprotein A OS=Xenopus laevis GN=snrpa PE=2 SV=1 20 119 2.0E-22
sp|B8AM21|RU2B_ORYSI U2 small nuclear ribonucleoprotein B'' OS=Oryza sativa subsp. indica GN=OsI_11177 PE=3 SV=1 24 118 3.0E-22
sp|Q62189|SNRPA_MOUSE U1 small nuclear ribonucleoprotein A OS=Mus musculus GN=Snrpa PE=1 SV=3 20 119 3.0E-22
sp|Q10MR0|RU2B_ORYSJ U2 small nuclear ribonucleoprotein B'' OS=Oryza sativa subsp. japonica GN=Os03g0298800 PE=2 SV=1 24 118 8.0E-22
sp|Q0DKM4|RU1A_ORYSJ U1 small nuclear ribonucleoprotein A OS=Oryza sativa subsp. japonica GN=Os05g0154800 PE=3 SV=1 24 119 8.0E-22
sp|A2Y0J7|RU1A_ORYSI U1 small nuclear ribonucleoprotein A OS=Oryza sativa subsp. indica GN=OsI_18512 PE=3 SV=1 24 119 8.0E-22
sp|P43332|SNRPA_DROME U1 small nuclear ribonucleoprotein A OS=Drosophila melanogaster GN=snf PE=1 SV=1 25 119 4.0E-21
sp|O74968|RU1A_SCHPO U1 small nuclear ribonucleoprotein usp102 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=usp102 PE=1 SV=1 17 112 2.0E-17
sp|Q39244|RU1A_ARATH U1 small nuclear ribonucleoprotein A OS=Arabidopsis thaliana GN=U1A PE=1 SV=1 25 119 3.0E-17
sp|P40567|MSL1_YEAST U2 small nuclear ribonucleoprotein B'' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSL1 PE=1 SV=1 23 109 5.0E-13
sp|P59708|SF3B6_MOUSE Splicing factor 3B subunit 6 OS=Mus musculus GN=Sf3b6 PE=1 SV=1 1 116 3.0E-08
sp|Q9Y3B4|SF3B6_HUMAN Splicing factor 3B subunit 6 OS=Homo sapiens GN=SF3B6 PE=1 SV=1 1 116 3.0E-08
sp|O59670|SF3B6_SCHPO Splicing factor 3B subunit 6-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A3.07c PE=3 SV=2 26 117 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3721
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1688
Ophiocordyceps australis map64 (Brazil) OphauB2|2283
Ophiocordyceps camponoti-floridani Ophcf2|07190
Ophiocordyceps camponoti-rufipedis Ophun1|2341 (this protein)
Ophiocordyceps kimflemingae Ophio5|554
Ophiocordyceps subramaniannii Hirsu2|7260

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2341
MASKAPGRSLAPNSSLPNKVQSTPPNQTLYITNLPSNKIQKADLRQGLYMLFSTYGPVLDVVCLKTMSMRGQAHI
VYRDIQTSTQAMRHLDGQNFLGRPMKIEYAKSKSHFVSKLDGTFKIPSTSTGAVSVEQTELQKSIFDAPFPGSAP
TAGASATNADQPMTEANAAGSRGTKRPRDEGDESEEDVAMEEDSDDE*
Coding >Ophun1|2341
ATGGCGTCCAAGGCACCCGGCCGCAGCCTGGCGCCGAACTCGTCTCTACCGAACAAGGTCCAATCGACGCCCCCA
AACCAAACTCTCTACATCACCAACCTCCCGTCCAACAAGATTCAGAAAGCCGACTTGCGACAGGGGCTCTACATG
CTGTTTTCCACCTACGGCCCTGTGCTCGACGTCGTTTGCCTCAAGACGATGAGTATGCGAGGCCAGGCTCATATT
GTCTACCGAGACATACAAACCTCAACTCAAGCCATGAGACACCTGGACGGACAGAATTTTCTGGGCCGCCCGATG
AAAATCGAGTACGCAAAGTCCAAGTCACACTTTGTGTCAAAGCTGGACGGAACGTTCAAGATACCGAGCACCTCG
ACAGGTGCCGTCAGCGTCGAACAAACGGAATTACAGAAGAGCATATTTGATGCCCCGTTCCCTGGCTCTGCTCCC
ACTGCCGGTGCTTCTGCGACAAACGCGGATCAGCCCATGACGGAGGCCAACGCGGCCGGTAGCCGTGGTACAAAG
CGGCCTCGCGACGAAGGGGACGAGAGCGAAGAAGACGTGGCGATGGAGGAGGACAGCGACGACGAATAA
Transcript >Ophun1|2341
ATGGCGTCCAAGGCACCCGGCCGCAGCCTGGCGCCGAACTCGTCTCTACCGAACAAGGTCCAATCGACGCCCCCA
AACCAAACTCTCTACATCACCAACCTCCCGTCCAACAAGATTCAGAAAGCCGACTTGCGACAGGGGCTCTACATG
CTGTTTTCCACCTACGGCCCTGTGCTCGACGTCGTTTGCCTCAAGACGATGAGTATGCGAGGCCAGGCTCATATT
GTCTACCGAGACATACAAACCTCAACTCAAGCCATGAGACACCTGGACGGACAGAATTTTCTGGGCCGCCCGATG
AAAATCGAGTACGCAAAGTCCAAGTCACACTTTGTGTCAAAGCTGGACGGAACGTTCAAGATACCGAGCACCTCG
ACAGGTGCCGTCAGCGTCGAACAAACGGAATTACAGAAGAGCATATTTGATGCCCCGTTCCCTGGCTCTGCTCCC
ACTGCCGGTGCTTCTGCGACAAACGCGGATCAGCCCATGACGGAGGCCAACGCGGCCGGTAGCCGTGGTACAAAG
CGGCCTCGCGACGAAGGGGACGAGAGCGAAGAAGACGTGGCGATGGAGGAGGACAGCGACGACGAATAA
Gene >Ophun1|2341
ATGGCGTCCAAGGCACCCGGCCGCAGCCTGGCGCCGAACTCGTCTCTACCGAACAAGGTCCAATCGACGCCCCCA
AACCAAACGTGAGCTCAAGCCCTATGTTCTTCATTCTCTTGTGAGCCGAGAGGTCTGATATAAAGCCATTAAGTC
TCTACATCACCAACCTCCCGTCCAACAAGATTCAGAAAGCCGACTTGCGACAGGGGCTCTACATGCTGTTTTCCA
CCTACGGCCCTGTGCTCGACGTCGTTTGCCTCAAGACGATGAGTATGCGAGGCCAGGCTCATATTGTCTACCGAG
ACATACAAACCTCAACTCAAGCCATGAGACACCTGGACGGACAGAATTTTCTGGGCCGCCCGATGGTGCGTTCCA
CGTTCCAACGCCGCGGCAGAGACACGGCTGATCAGCAGTAGAAAATCGAGTACGCAAAGTCCAAGTCACACTTTG
TGTCAAAGCTGGACGGAACGTTCAAGATACCGAGCACCTCGACAGGTGCCGTCAGCGTCGAACAAACGGAATTAC
AGAAGAGCATATTTGATGCCCCGTTCCCTGGCTCTGCTCCCACTGCCGGTGCTTCTGCGACAAACGCGGATCAGC
CCATGACGGAGGCCAACGCGGCCGGTAGCCGTGGTACAAAGCGGCCTCGCGACGAAGGGGACGAGAGCGAAGAAG
ACGTGGCGATGGAGGAGGACAGCGACGACGAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail