Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2340
Gene name
LocationContig_214:3332..4220
Strand+
Gene length (bp)888
Transcript length (bp)780
Coding sequence length (bp)780
Protein length (aa) 260

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03987 Autophagy_act_C Autophagocytosis associated protein, active-site domain 1.5E-30 28 239

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9H0Y0|ATG10_HUMAN Ubiquitin-like-conjugating enzyme ATG10 OS=Homo sapiens GN=ATG10 PE=1 SV=1 82 242 7.0E-07

GO

GO Term Description Terminal node
GO:0019787 ubiquitin-like protein transferase activity Yes
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3722
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1687
Ophiocordyceps australis map64 (Brazil) OphauB2|2284
Ophiocordyceps camponoti-floridani Ophcf2|07191
Ophiocordyceps camponoti-rufipedis Ophun1|2340 (this protein)
Ophiocordyceps kimflemingae Ophio5|553
Ophiocordyceps subramaniannii Hirsu2|7261

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2340
MPNSFGVWSLPYCAMADIKHFPSLDRAEFSAACHHLDRQYRQATLGPLRRQWRLSLCAALDNGFSIDGTYTTYVQ
ITRPLEPMADCRDLSDAMGRVSFQDHDGADADMIGAEESDSEVIVKDSPRGDVAHVVYEIHLHPTYRIPCLWFTL
HHLPEDEAAFDIDTVFRRLVPEEYKSRLRGLGAIGGISADHHPITGVPAFFIHPCLLGDAIAGFPCSLDNYLIIW
LGLVGGCIGLWVPKEMALQDIGAPHQLSCRGARQ*
Coding >Ophun1|2340
ATGCCCAACTCCTTCGGCGTTTGGAGTCTGCCTTACTGCGCCATGGCCGATATTAAGCATTTCCCCTCGCTTGAC
CGAGCCGAATTCTCTGCTGCCTGCCATCATCTCGACCGTCAATATCGTCAAGCAACACTGGGCCCTTTACGGAGA
CAATGGAGGCTCAGCCTGTGTGCCGCGCTCGACAACGGCTTTTCCATCGACGGCACCTACACCACCTATGTCCAG
ATCACGCGTCCTTTGGAGCCCATGGCAGATTGCCGTGATCTGTCCGATGCCATGGGGAGAGTGTCTTTCCAAGAC
CACGACGGGGCAGACGCCGACATGATCGGTGCCGAGGAGTCTGATTCGGAGGTCATCGTCAAAGACAGCCCACGT
GGCGACGTTGCTCATGTTGTCTATGAGATCCATCTCCACCCGACCTACAGGATTCCCTGTCTCTGGTTCACCCTT
CACCACCTCCCAGAGGATGAAGCCGCCTTTGACATCGACACAGTCTTTCGCCGCCTGGTTCCCGAAGAGTACAAA
AGCAGACTCCGAGGACTGGGCGCCATAGGGGGTATATCTGCCGACCATCACCCCATCACGGGGGTCCCAGCCTTC
TTCATCCACCCGTGCCTTCTCGGAGACGCCATAGCGGGATTTCCATGTTCCCTCGACAACTATCTCATCATCTGG
CTCGGACTCGTCGGGGGGTGCATCGGCCTCTGGGTGCCGAAAGAAATGGCCTTACAGGACATCGGAGCTCCACAT
CAGCTTTCTTGCCGCGGGGCACGGCAATGA
Transcript >Ophun1|2340
ATGCCCAACTCCTTCGGCGTTTGGAGTCTGCCTTACTGCGCCATGGCCGATATTAAGCATTTCCCCTCGCTTGAC
CGAGCCGAATTCTCTGCTGCCTGCCATCATCTCGACCGTCAATATCGTCAAGCAACACTGGGCCCTTTACGGAGA
CAATGGAGGCTCAGCCTGTGTGCCGCGCTCGACAACGGCTTTTCCATCGACGGCACCTACACCACCTATGTCCAG
ATCACGCGTCCTTTGGAGCCCATGGCAGATTGCCGTGATCTGTCCGATGCCATGGGGAGAGTGTCTTTCCAAGAC
CACGACGGGGCAGACGCCGACATGATCGGTGCCGAGGAGTCTGATTCGGAGGTCATCGTCAAAGACAGCCCACGT
GGCGACGTTGCTCATGTTGTCTATGAGATCCATCTCCACCCGACCTACAGGATTCCCTGTCTCTGGTTCACCCTT
CACCACCTCCCAGAGGATGAAGCCGCCTTTGACATCGACACAGTCTTTCGCCGCCTGGTTCCCGAAGAGTACAAA
AGCAGACTCCGAGGACTGGGCGCCATAGGGGGTATATCTGCCGACCATCACCCCATCACGGGGGTCCCAGCCTTC
TTCATCCACCCGTGCCTTCTCGGAGACGCCATAGCGGGATTTCCATGTTCCCTCGACAACTATCTCATCATCTGG
CTCGGACTCGTCGGGGGGTGCATCGGCCTCTGGGTGCCGAAAGAAATGGCCTTACAGGACATCGGAGCTCCACAT
CAGCTTTCTTGCCGCGGGGCACGGCAATGA
Gene >Ophun1|2340
ATGCCCAACTCCTTCGGCGTTTGGAGTCTGCCTTACTGCGCCATGGCCGATATTAAGCATTTCCCCTCGCTTGAC
CGAGCCGAATTCTCTGCTGCCTGCCATCATCTCGACCGTCAATATCGTCAAGCAACACTGGGCCCTTTACGGAGA
CAATGGAGGCTCAGCCTGTGTGCCGCGCTCGACAACGGCTTTTCCATCGACGGCACCTACACCACCTATGTCCAG
ATCACGCGTCCTTTGGAGCCCATGGCAGATTGCCGTGATCTGTCCGATGCCATGGGGAGAGTGTCTTTCCAAGAC
CACGACGGGGCAGACGCCGACATGATCGGTGCCGAGGAGTCTGATTCGGTAGGACGCTCCATCGTCTCATCTGCT
TCTCACGTGCCCTGACCAGTCCTAGGAGGTCATCGTCAAAGACAGCCCACGTGGCGACGTTGCTCATGTTGTCTA
TGAGATCCATCTCCACCCGACCTACAGGATTCCCTGTCTCTGGTTCACCCTTCACCACCTCCCAGAGGATGAAGC
CGCCTTTGACATCGACACAGTCTTTCGCCGCCTGGTTCCCGAAGAGTACAAAAGCAGACTCCGAGGACTGGGCGC
CATAGGGGGTATATCTGCCGACGTAAGTCTGCAAGCCTAACAGTATCGACCGGGTCAGCGCTGACGGTCCCGTCT
CAGCATCACCCCATCACGGGGGTCCCAGCCTTCTTCATCCACCCGTGCCTTCTCGGAGACGCCATAGCGGGATTT
CCATGTTCCCTCGACAACTATCTCATCATCTGGCTCGGACTCGTCGGGGGGTGCATCGGCCTCTGGGTGCCGAAA
GAAATGGCCTTACAGGACATCGGAGCTCCACATCAGCTTTCTTGCCGCGGGGCACGGCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail