Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2331
Gene name
LocationContig_213:9480..10674
Strand+
Gene length (bp)1194
Transcript length (bp)1194
Coding sequence length (bp)1194
Protein length (aa) 398

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07065 D123 D123 3.1E-107 33 376

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6SDA8|CD123_BOTFB Cell division cycle protein 123 OS=Botryotinia fuckeliana (strain B05.10) GN=cdc123 PE=3 SV=1 15 397 3.0E-129
sp|A7EUE6|CD123_SCLS1 Cell division cycle protein 123 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=CDC123 PE=3 SV=1 15 397 4.0E-129
sp|Q2U988|CD123_ASPOR Cell division cycle protein 123 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cdc123 PE=3 SV=1 6 394 3.0E-96
sp|Q4WDA4|CD123_ASPFU Cell division cycle protein 123 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cdc123 PE=3 SV=1 15 394 5.0E-94
sp|A1CMB9|CD123_ASPCL Cell division cycle protein 123 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cdc123 PE=3 SV=1 6 394 1.0E-93
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6SDA8|CD123_BOTFB Cell division cycle protein 123 OS=Botryotinia fuckeliana (strain B05.10) GN=cdc123 PE=3 SV=1 15 397 3.0E-129
sp|A7EUE6|CD123_SCLS1 Cell division cycle protein 123 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=CDC123 PE=3 SV=1 15 397 4.0E-129
sp|Q2U988|CD123_ASPOR Cell division cycle protein 123 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cdc123 PE=3 SV=1 6 394 3.0E-96
sp|Q4WDA4|CD123_ASPFU Cell division cycle protein 123 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cdc123 PE=3 SV=1 15 394 5.0E-94
sp|A1CMB9|CD123_ASPCL Cell division cycle protein 123 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cdc123 PE=3 SV=1 6 394 1.0E-93
sp|Q5AYN6|CD123_EMENI Cell division cycle protein 123 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cdc123 PE=3 SV=1 15 394 2.0E-93
sp|Q0CH08|CD123_ASPTN Cell division cycle protein 123 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cdc123 PE=3 SV=1 1 396 8.0E-93
sp|A1DLP3|CD123_NEOFI Cell division cycle protein 123 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cdc123 PE=3 SV=1 15 394 2.0E-92
sp|Q0V340|CD123_PHANO Cell division cycle protein 123 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CDC123 PE=3 SV=2 34 393 1.0E-90
sp|A6R687|CD123_AJECN Cell division cycle protein 123 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=CDC123 PE=3 SV=1 15 394 9.0E-90
sp|A2R4R1|CD123_ASPNC Cell division cycle protein 123 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cdc123 PE=3 SV=1 15 396 2.0E-88
sp|A7TPB3|CD123_VANPO Cell division cycle protein 123 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CDC123 PE=3 SV=1 11 396 3.0E-68
sp|Q6FNU7|CD123_CANGA Cell division cycle protein 123 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CDC123 PE=3 SV=1 19 394 3.0E-62
sp|Q05791|CD123_YEAST Cell division cycle protein 123 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC123 PE=1 SV=1 19 394 2.0E-61
sp|A7A1A3|CD123_YEAS7 Cell division cycle protein 123 OS=Saccharomyces cerevisiae (strain YJM789) GN=CDC123 PE=3 SV=1 19 394 2.0E-61
sp|Q6C101|CD123_YARLI Cell division cycle protein 123 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CDC123 PE=3 SV=1 22 394 4.0E-59
sp|Q6CL84|CD123_KLULA Cell division cycle protein 123 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CDC123 PE=3 SV=1 14 394 5.0E-58
sp|Q8CII2|CD123_MOUSE Cell division cycle protein 123 homolog OS=Mus musculus GN=Cdc123 PE=1 SV=2 20 336 2.0E-57
sp|Q2YDG3|CD123_BOVIN Cell division cycle protein 123 homolog OS=Bos taurus GN=CDC123 PE=2 SV=1 20 382 3.0E-57
sp|Q9P7N5|CD123_SCHPO Cell division cycle protein 123 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc123 PE=1 SV=1 20 396 5.0E-57
sp|O75794|CD123_HUMAN Cell division cycle protein 123 homolog OS=Homo sapiens GN=CDC123 PE=1 SV=1 20 308 7.0E-57
sp|Q2PG37|CD123_MACFA Cell division cycle protein 123 homolog OS=Macaca fascicularis GN=CDC123 PE=2 SV=1 20 308 7.0E-56
sp|Q62834|CD123_RAT Cell division cycle protein 123 homolog OS=Rattus norvegicus GN=Cdc123 PE=1 SV=1 20 306 4.0E-55
sp|A7RFT2|CD123_NEMVE Cell division cycle protein 123 homolog OS=Nematostella vectensis GN=cdc123 PE=3 SV=1 20 316 8.0E-55
sp|Q641C9|CD123_XENLA Cell division cycle protein 123 homolog OS=Xenopus laevis GN=cdc123 PE=2 SV=1 20 306 2.0E-54
sp|Q5BKN5|CD123_XENTR Cell division cycle protein 123 homolog OS=Xenopus tropicalis GN=cdc123 PE=2 SV=1 20 306 2.0E-54
sp|A5E3J7|CD123_LODEL Cell division cycle protein 123 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=CDC123 PE=3 SV=1 20 396 2.0E-51
sp|Q6PC40|CD123_DANRE Cell division cycle protein 123 homolog OS=Danio rerio GN=cdc123 PE=2 SV=1 20 306 6.0E-50
sp|Q75A37|CD123_ASHGO Cell division cycle protein 123 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CDC123 PE=3 SV=1 20 394 4.0E-49
sp|Q75JF9|CD123_DICDI Cell division cycle protein 123 homolog OS=Dictyostelium discoideum GN=cdc123 PE=3 SV=1 28 307 3.0E-46
sp|Q5AFX2|CD123_CANAL Cell division cycle protein 123 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC123 PE=3 SV=1 20 396 5.0E-39
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2331
MPHLPSNDAPDSIPLAFPPVTKDHILNCSYDAWFPTYRASCLKSRIIPLPPSVVSYLKEDGIVLADDGADRRPEE
EDEEWHTDTTTSWRKPAPSDDSDSDSDSGSEPEKAPVPPDKRFPETHKLIADTITDLGGAVAPKLNWSSPKDATW
VSRHQNTLKCTSPNDIYLLLKSSLFASHDLSHAFDGCTDAPPGRPRSTVLVLRPFFTPHAALEFRCFVKHRCLVG
ITQRDLNYYGFLAGLRPRIRRKIVDFFGRTLRRTFADASFVFDVYVPEDPSEDDGLGRVRLMDINPWAPRTDTLL
FSWDELLAFDVPAPLYGSATGDSDPPDADDASCTSAGSDESAGPELRLIEHDDPAAFNFSAPQYSAHKLPREVVE
AGSSGEAGLREFAQRWRELTGG*
Coding >Ophun1|2331
ATGCCTCATCTCCCCTCGAACGACGCACCGGATTCAATCCCTCTTGCTTTCCCACCAGTGACAAAAGATCACATC
CTAAATTGCTCGTACGACGCATGGTTCCCGACCTACCGGGCATCATGCCTCAAGTCGCGCATCATCCCGCTGCCG
CCGAGCGTCGTCTCGTACCTAAAGGAGGATGGTATAGTGCTGGCAGACGACGGCGCGGACCGGAGACCGGAGGAG
GAAGATGAAGAGTGGCATACAGACACGACGACATCTTGGAGGAAGCCGGCGCCAAGTGACGACTCCGACTCCGAC
TCCGACTCCGGCTCAGAACCGGAGAAGGCACCGGTACCGCCCGACAAACGCTTTCCCGAGACGCACAAGCTCATA
GCCGACACAATCACCGATCTAGGCGGCGCCGTAGCCCCCAAGCTAAACTGGTCGTCCCCCAAAGACGCAACCTGG
GTCTCACGACACCAGAACACACTCAAGTGCACATCCCCCAACGACATCTACCTCCTCCTCAAATCCTCTCTCTTC
GCCTCACACGACCTCTCTCACGCCTTCGACGGCTGCACAGACGCACCTCCAGGCCGGCCCCGATCCACGGTCCTG
GTGCTCCGACCCTTCTTCACGCCCCACGCGGCGCTCGAGTTCCGCTGCTTCGTCAAGCATCGCTGCCTGGTGGGC
ATCACGCAACGCGATCTCAACTACTACGGCTTTCTGGCGGGGTTGAGGCCGCGCATTCGTCGCAAGATTGTTGAT
TTCTTTGGCCGTACGCTGCGGAGGACTTTTGCCGATGCGAGCTTCGTCTTCGACGTCTACGTTCCTGAGGATCCA
TCAGAGGACGATGGTCTGGGAAGGGTTCGCCTAATGGACATCAATCCGTGGGCGCCCCGGACAGACACTCTTTTA
TTCTCGTGGGATGAGCTGCTGGCCTTTGACGTGCCGGCGCCGCTGTACGGCTCAGCCACCGGGGATTCAGACCCA
CCTGATGCCGACGACGCCTCCTGCACCTCAGCCGGATCAGACGAAAGCGCGGGTCCGGAGCTCCGGCTGATCGAG
CACGACGACCCAGCAGCCTTCAACTTCAGCGCGCCGCAGTATTCGGCTCACAAGCTCCCGCGGGAGGTGGTCGAG
GCCGGGTCATCAGGCGAGGCAGGGCTGCGGGAGTTTGCCCAGCGGTGGAGGGAGCTTACTGGCGGGTAG
Transcript >Ophun1|2331
ATGCCTCATCTCCCCTCGAACGACGCACCGGATTCAATCCCTCTTGCTTTCCCACCAGTGACAAAAGATCACATC
CTAAATTGCTCGTACGACGCATGGTTCCCGACCTACCGGGCATCATGCCTCAAGTCGCGCATCATCCCGCTGCCG
CCGAGCGTCGTCTCGTACCTAAAGGAGGATGGTATAGTGCTGGCAGACGACGGCGCGGACCGGAGACCGGAGGAG
GAAGATGAAGAGTGGCATACAGACACGACGACATCTTGGAGGAAGCCGGCGCCAAGTGACGACTCCGACTCCGAC
TCCGACTCCGGCTCAGAACCGGAGAAGGCACCGGTACCGCCCGACAAACGCTTTCCCGAGACGCACAAGCTCATA
GCCGACACAATCACCGATCTAGGCGGCGCCGTAGCCCCCAAGCTAAACTGGTCGTCCCCCAAAGACGCAACCTGG
GTCTCACGACACCAGAACACACTCAAGTGCACATCCCCCAACGACATCTACCTCCTCCTCAAATCCTCTCTCTTC
GCCTCACACGACCTCTCTCACGCCTTCGACGGCTGCACAGACGCACCTCCAGGCCGGCCCCGATCCACGGTCCTG
GTGCTCCGACCCTTCTTCACGCCCCACGCGGCGCTCGAGTTCCGCTGCTTCGTCAAGCATCGCTGCCTGGTGGGC
ATCACGCAACGCGATCTCAACTACTACGGCTTTCTGGCGGGGTTGAGGCCGCGCATTCGTCGCAAGATTGTTGAT
TTCTTTGGCCGTACGCTGCGGAGGACTTTTGCCGATGCGAGCTTCGTCTTCGACGTCTACGTTCCTGAGGATCCA
TCAGAGGACGATGGTCTGGGAAGGGTTCGCCTAATGGACATCAATCCGTGGGCGCCCCGGACAGACACTCTTTTA
TTCTCGTGGGATGAGCTGCTGGCCTTTGACGTGCCGGCGCCGCTGTACGGCTCAGCCACCGGGGATTCAGACCCA
CCTGATGCCGACGACGCCTCCTGCACCTCAGCCGGATCAGACGAAAGCGCGGGTCCGGAGCTCCGGCTGATCGAG
CACGACGACCCAGCAGCCTTCAACTTCAGCGCGCCGCAGTATTCGGCTCACAAGCTCCCGCGGGAGGTGGTCGAG
GCCGGGTCATCAGGCGAGGCAGGGCTGCGGGAGTTTGCCCAGCGGTGGAGGGAGCTTACTGGCGGGTAG
Gene >Ophun1|2331
ATGCCTCATCTCCCCTCGAACGACGCACCGGATTCAATCCCTCTTGCTTTCCCACCAGTGACAAAAGATCACATC
CTAAATTGCTCGTACGACGCATGGTTCCCGACCTACCGGGCATCATGCCTCAAGTCGCGCATCATCCCGCTGCCG
CCGAGCGTCGTCTCGTACCTAAAGGAGGATGGTATAGTGCTGGCAGACGACGGCGCGGACCGGAGACCGGAGGAG
GAAGATGAAGAGTGGCATACAGACACGACGACATCTTGGAGGAAGCCGGCGCCAAGTGACGACTCCGACTCCGAC
TCCGACTCCGGCTCAGAACCGGAGAAGGCACCGGTACCGCCCGACAAACGCTTTCCCGAGACGCACAAGCTCATA
GCCGACACAATCACCGATCTAGGCGGCGCCGTAGCCCCCAAGCTAAACTGGTCGTCCCCCAAAGACGCAACCTGG
GTCTCACGACACCAGAACACACTCAAGTGCACATCCCCCAACGACATCTACCTCCTCCTCAAATCCTCTCTCTTC
GCCTCACACGACCTCTCTCACGCCTTCGACGGCTGCACAGACGCACCTCCAGGCCGGCCCCGATCCACGGTCCTG
GTGCTCCGACCCTTCTTCACGCCCCACGCGGCGCTCGAGTTCCGCTGCTTCGTCAAGCATCGCTGCCTGGTGGGC
ATCACGCAACGCGATCTCAACTACTACGGCTTTCTGGCGGGGTTGAGGCCGCGCATTCGTCGCAAGATTGTTGAT
TTCTTTGGCCGTACGCTGCGGAGGACTTTTGCCGATGCGAGCTTCGTCTTCGACGTCTACGTTCCTGAGGATCCA
TCAGAGGACGATGGTCTGGGAAGGGTTCGCCTAATGGACATCAATCCGTGGGCGCCCCGGACAGACACTCTTTTA
TTCTCGTGGGATGAGCTGCTGGCCTTTGACGTGCCGGCGCCGCTGTACGGCTCAGCCACCGGGGATTCAGACCCA
CCTGATGCCGACGACGCCTCCTGCACCTCAGCCGGATCAGACGAAAGCGCGGGTCCGGAGCTCCGGCTGATCGAG
CACGACGACCCAGCAGCCTTCAACTTCAGCGCGCCGCAGTATTCGGCTCACAAGCTCCCGCGGGAGGTGGTCGAG
GCCGGGTCATCAGGCGAGGCAGGGCTGCGGGAGTTTGCCCAGCGGTGGAGGGAGCTTACTGGCGGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail