Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2320
Gene name
LocationContig_212:23545..24867
Strand-
Gene length (bp)1322
Transcript length (bp)1167
Coding sequence length (bp)1167
Protein length (aa) 389

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4RM13|GMT_MAGO7 GDP-mannose transporter OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=VRG4 PE=3 SV=1 1 367 7.0E-165
sp|Q2HA88|GMT_CHAGB GDP-mannose transporter OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VRG4 PE=3 SV=2 1 367 7.0E-163
sp|Q7SBC5|GMT_NEUCR GDP-mannose transporter OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vrg-4 PE=3 SV=1 7 384 7.0E-161
sp|A7E558|GMT_SCLS1 GDP-mannose transporter OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=vrg4 PE=3 SV=1 1 383 1.0E-158
sp|Q5AQY2|GMT2_EMENI GDP-mannose transporter 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gmt2 PE=3 SV=2 22 357 4.0E-156
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4RM13|GMT_MAGO7 GDP-mannose transporter OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=VRG4 PE=3 SV=1 1 367 7.0E-165
sp|Q2HA88|GMT_CHAGB GDP-mannose transporter OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VRG4 PE=3 SV=2 1 367 7.0E-163
sp|Q7SBC5|GMT_NEUCR GDP-mannose transporter OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vrg-4 PE=3 SV=1 7 384 7.0E-161
sp|A7E558|GMT_SCLS1 GDP-mannose transporter OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=vrg4 PE=3 SV=1 1 383 1.0E-158
sp|Q5AQY2|GMT2_EMENI GDP-mannose transporter 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gmt2 PE=3 SV=2 22 357 4.0E-156
sp|A6RJQ8|GMT_BOTFB GDP-mannose transporter OS=Botryotinia fuckeliana (strain B05.10) GN=gmt1 PE=3 SV=1 1 384 1.0E-155
sp|A1DA52|GMT2_NEOFI GDP-mannose transporter 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=gmt2 PE=3 SV=1 22 357 4.0E-154
sp|Q0UG89|GMT_PHANO GDP-mannose transporter OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=VRG4 PE=3 SV=1 4 367 2.0E-135
sp|A1C9R4|GMT_ASPCL GDP-mannose transporter OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=gmt1 PE=3 SV=1 4 368 3.0E-132
sp|Q2UTL1|GMT_ASPOR GDP-mannose transporter OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gmt1 PE=3 SV=2 1 368 1.0E-131
sp|Q1DTI4|GMT_COCIM GDP-mannose transporter OS=Coccidioides immitis (strain RS) GN=VRG4 PE=3 SV=2 48 367 7.0E-129
sp|Q5AS82|GMT1_EMENI GDP-mannose transporter 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gmt1 PE=3 SV=2 4 367 7.0E-129
sp|A2R9P4|GMT_ASPNC GDP-mannose transporter OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=gmt1 PE=3 SV=1 2 368 7.0E-129
sp|A1CZJ3|GMT1_NEOFI GDP-mannose transporter 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=gmt1 PE=3 SV=1 4 362 2.0E-128
sp|Q4WTQ6|GMT_ASPFU GDP-mannose transporter OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gmt1 PE=3 SV=1 4 362 2.0E-127
sp|B0Y384|GMT_ASPFC GDP-mannose transporter OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=gmt1 PE=3 SV=1 4 362 2.0E-127
sp|Q0CA27|GMT_ASPTN GDP-mannose transporter OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=gmt1 PE=3 SV=1 4 366 2.0E-126
sp|Q6C0U0|GMT_YARLI GDP-mannose transporter OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=VRG4 PE=3 SV=1 36 366 3.0E-121
sp|Q9UTK8|GMT_SCHPO GDP-mannose transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vrg4 PE=3 SV=1 36 362 8.0E-121
sp|B0DI84|GMT_LACBS GDP-mannose transporter OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=VRG4 PE=3 SV=1 48 364 5.0E-114
sp|P0CS04|GMT2_CRYNJ GDP-mannose transporter 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GMT2 PE=2 SV=1 20 363 2.0E-113
sp|P0CS05|GMT2_CRYNB GDP-mannose transporter 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GMT2 PE=3 SV=1 20 363 2.0E-113
sp|A3LWX1|GMT_PICST GDP-mannose transporter OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=VRG4 PE=3 SV=1 34 368 4.0E-110
sp|P0CS02|GMT1_CRYNJ GDP-mannose transporter 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GMT1 PE=2 SV=1 48 363 2.0E-109
sp|P0CS03|GMT1_CRYNB GDP-mannose transporter 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GMT1 PE=3 SV=1 48 363 2.0E-109
sp|Q4PFQ1|GMT_USTMA GDP-mannose transporter OS=Ustilago maydis (strain 521 / FGSC 9021) GN=VRG4 PE=3 SV=1 48 378 7.0E-109
sp|Q2AAF6|GMT_PICPA GDP-mannose transporter OS=Komagataella pastoris GN=VIG4 PE=3 SV=1 39 367 1.0E-106
sp|Q5A477|GMT_CANAL GDP-mannose transporter OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VRG4 PE=3 SV=1 38 352 2.0E-106
sp|A8N9T6|GMT_COPC7 GDP-mannose transporter OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=VRG4 PE=3 SV=2 64 362 3.0E-106
sp|A5DIN8|GMT_PICGU GDP-mannose transporter OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=VRG4 PE=3 SV=1 38 368 1.0E-104
sp|P40107|GMT1_YEAST GDP-mannose transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VRG4 PE=1 SV=1 23 365 3.0E-104
sp|C8Z830|GMT1_YEAS8 GDP-mannose transporter 1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=VRG4 PE=3 SV=1 23 365 3.0E-104
sp|A6ZTW6|GMT1_YEAS7 GDP-mannose transporter 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=VRG4 PE=3 SV=1 23 365 3.0E-104
sp|C7GUZ7|GMT1_YEAS2 GDP-mannose transporter 1 OS=Saccharomyces cerevisiae (strain JAY291) GN=VRG4 PE=3 SV=1 23 365 3.0E-104
sp|B3LHR7|GMT1_YEAS1 GDP-mannose transporter 1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=VRG4 PE=3 SV=1 23 365 3.0E-104
sp|A7TR80|GMT1_VANPO GDP-mannose transporter 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=VRG4-1 PE=3 SV=1 39 362 6.0E-103
sp|Q6FRE5|GMT_CANGA GDP-mannose transporter OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=VRG4 PE=3 SV=1 39 362 1.0E-101
sp|Q6CYD0|GMT_KLULA GDP-mannose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=VRG4 PE=3 SV=1 37 368 2.0E-100
sp|C8Z742|GMT2_YEAS8 Probable GDP-mannose transporter 2 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=HVG1 PE=3 SV=1 38 352 2.0E-98
sp|Q753T9|GMT_ASHGO GDP-mannose transporter OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VRG4 PE=3 SV=2 37 362 8.0E-96
sp|A8PTV6|GMT_MALGO GDP-mannose transporter OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=VRG4 PE=3 SV=1 42 359 2.0E-94
sp|A7TES5|GMT2_VANPO GDP-mannose transporter 2 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=VRG4-2 PE=3 SV=1 42 363 2.0E-88
sp|P0CE11|GMT2_YEAST Probable GDP-mannose transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HVG1 PE=3 SV=1 122 352 1.0E-76
sp|B5VHH5|GMT2_YEAS6 Probable GDP-mannose transporter 2 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=HVG1 PE=3 SV=1 122 352 1.0E-76
sp|C7GSI5|GMT2_YEAS2 Probable GDP-mannose transporter 2 OS=Saccharomyces cerevisiae (strain JAY291) GN=HVG1 PE=3 SV=1 122 352 1.0E-76
sp|B3LS51|GMT2_YEAS1 Probable GDP-mannose transporter 2 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=HVG1 PE=3 SV=1 122 352 1.0E-76
sp|Q941R4|GONS1_ARATH GDP-mannose transporter GONST1 OS=Arabidopsis thaliana GN=GONST1 PE=1 SV=2 50 359 4.0E-34
sp|Q84L09|GONS2_ARATH GDP-mannose transporter GONST2 OS=Arabidopsis thaliana GN=GONST2 PE=2 SV=1 25 356 2.0E-31
sp|Q95YI5|US74C_DROME UDP-sugar transporter UST74c OS=Drosophila melanogaster GN=frc PE=1 SV=2 51 367 9.0E-11
sp|Q968A5|FUCT1_CAEEL GDP-fucose transporter OS=Caenorhabditis elegans GN=C50F4.14 PE=1 SV=1 47 358 3.0E-10
sp|Q8BLX4|FUCT1_MOUSE GDP-fucose transporter 1 OS=Mus musculus GN=Slc35c1 PE=2 SV=1 10 362 6.0E-09
sp|Q54YK1|Y8631_DICDI Putative UDP-sugar transporter DDB_G0278631 OS=Dictyostelium discoideum GN=DDB_G0278631 PE=3 SV=2 77 334 8.0E-09
sp|Q96A29|FUCT1_HUMAN GDP-fucose transporter 1 OS=Homo sapiens GN=SLC35C1 PE=1 SV=1 12 362 3.0E-08
sp|Q3UME2|TM241_MOUSE Transmembrane protein 241 OS=Mus musculus GN=Tmem241 PE=2 SV=2 51 274 4.0E-08
sp|Q84L08|GONS4_ARATH GDP-mannose transporter GONST4 OS=Arabidopsis thaliana GN=GONST4 PE=2 SV=1 48 320 5.0E-08
sp|A6QM03|FUCT1_BOVIN GDP-fucose transporter 1 OS=Bos taurus GN=SLC35C1 PE=2 SV=1 29 362 1.0E-07
sp|A1L3G4|TM241_XENLA Transmembrane protein 241 OS=Xenopus laevis GN=tmem241 PE=2 SV=1 51 258 2.0E-07
sp|Q15B89|S35D2_PIG UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose transporter (Fragment) OS=Sus scrofa GN=SLC35D2 PE=2 SV=1 17 363 2.0E-07
sp|A2VE55|S35D2_BOVIN UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose transporter OS=Bos taurus GN=SLC35D2 PE=2 SV=1 17 363 3.0E-07
sp|A9UUB8|FUCT1_MONBE GDP-fucose transporter 1 OS=Monosiga brevicollis GN=slc35c1 PE=3 SV=1 48 254 4.0E-07
sp|Q24JQ0|TM241_HUMAN Transmembrane protein 241 OS=Homo sapiens GN=TMEM241 PE=2 SV=1 51 258 2.0E-06
sp|Q9NTN3|S35D1_HUMAN UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter OS=Homo sapiens GN=SLC35D1 PE=1 SV=1 51 363 2.0E-06
sp|P0CD97|YR039_YEAST Uncharacterized protein YER039C-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YER039C-A PE=1 SV=1 38 97 3.0E-06
sp|B3LS52|YR039_YEAS1 Uncharacterized protein SCRG_04509 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SCRG_04509 PE=3 SV=1 38 97 3.0E-06
sp|C7GSI6|YR039_YEAS2 Uncharacterized protein C1Q_03362 OS=Saccharomyces cerevisiae (strain JAY291) GN=C1Q_03362 PE=3 SV=1 38 97 3.0E-06
sp|A6ZQY8|YR039_YEAS7 Uncharacterized protein SCY_1535 OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_1535 PE=3 SV=1 38 97 3.0E-06
sp|Q5RDC9|S35D2_PONAB UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose transporter OS=Pongo abelii GN=SLC35D2 PE=2 SV=1 51 363 6.0E-06
sp|Q18779|SQV7_CAEEL UDP-sugar transporter sqv-7 OS=Caenorhabditis elegans GN=sqv-7 PE=1 SV=1 36 358 7.0E-06
sp|A7S1L6|FUCT1_NEMVE GDP-fucose transporter 1 OS=Nematostella vectensis GN=slc35c1 PE=3 SV=1 48 335 7.0E-06
sp|Q76EJ3|S35D2_HUMAN UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose transporter OS=Homo sapiens GN=SLC35D2 PE=1 SV=1 51 332 8.0E-06
sp|Q9S845|GONS3_ARATH GDP-mannose transporter GONST3 OS=Arabidopsis thaliana GN=GONST3 PE=2 SV=1 49 384 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 44 66 22
2 73 92 19
3 130 152 22
4 159 181 22
5 201 223 22
6 244 261 17
7 281 303 22
8 310 329 19
9 333 355 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2320
MSAKKSDDFVVRVPEISLSRADEKLPLAADGRSPSMLSSVESSGGVSVAAYCLSSISMTLVNKYVVSGNQWNLHL
LYLAIQSIVGTFTILVCKQAGLIKDLDPFDTRRAKKWFPISLLLVGMIFTGNKALQFLSVPVYTIFKNLTIIVIA
YGEMMWFGGSVSPLSLVSFVLMVSSSMLAAWADFHSVRTDASGAAHRAATAAATATLSTGYAWMGLNVMCSALYV
LSMRKAIKITNLKNWDVMFYNNLLTIPVLVLSSLMIEDWSGANLARNFPPATRQSLMIGMIYSGLAAIFISYCTA
WCIRATSSTTYAMAGALNKLPMAVAGLVFFSDPVTFGSVSAIFLGFVSGLIYTWAKNRKSRQAGLPTAVSRATSG
TLSPHEKADVAKD*
Coding >Ophun1|2320
ATGTCTGCCAAGAAGAGCGACGATTTCGTCGTTCGCGTCCCGGAAATCAGCCTTTCGCGCGCCGACGAGAAGCTG
CCGCTGGCCGCCGATGGCCGGTCGCCGTCGATGCTGTCGTCGGTCGAGAGCAGCGGCGGCGTCTCCGTCGCTGCC
TACTGCCTGTCGTCCATCAGCATGACGCTCGTCAACAAGTACGTCGTGTCGGGGAATCAGTGGAATCTTCATCTG
CTGTACCTGGCCATCCAGTCTATCGTTGGCACTTTCACTATCCTCGTCTGCAAGCAGGCCGGCCTCATCAAGGAT
CTCGACCCTTTTGACACGAGGAGAGCCAAGAAGTGGTTCCCCATCTCGCTACTGCTCGTCGGCATGATCTTCACG
GGAAACAAGGCGCTGCAGTTTCTGTCAGTGCCCGTCTACACCATCTTCAAGAACCTGACCATCATCGTCATTGCA
TACGGAGAGATGATGTGGTTCGGCGGCAGCGTCAGCCCGCTGAGCCTCGTCTCCTTTGTGCTAATGGTCTCGAGC
TCGATGCTGGCGGCCTGGGCCGACTTTCACAGCGTCCGGACCGATGCTTCGGGCGCTGCTCACAGGGCCGCCACG
GCCGCCGCCACGGCGACGTTGAGCACGGGCTACGCCTGGATGGGCCTCAACGTCATGTGCTCGGCGCTGTACGTG
CTGAGCATGCGCAAGGCCATCAAGATTACCAACCTCAAGAACTGGGACGTCATGTTCTACAACAATCTGCTGACC
ATTCCGGTCCTGGTCCTCTCGTCTCTCATGATAGAGGACTGGTCCGGCGCCAACCTGGCGCGCAACTTCCCGCCG
GCGACGCGCCAGAGCCTGATGATCGGCATGATCTACTCGGGCCTGGCTGCCATCTTCATCTCGTACTGCACGGCC
TGGTGCATCCGCGCCACATCGTCGACGACGTACGCCATGGCCGGCGCCCTCAACAAGCTGCCCATGGCTGTCGCC
GGCCTCGTCTTCTTCTCCGACCCCGTCACGTTTGGCAGCGTGTCGGCCATCTTCCTCGGCTTCGTCAGCGGTCTC
ATCTACACGTGGGCCAAGAACAGAAAGTCGCGACAGGCCGGTCTGCCGACGGCTGTCAGCCGCGCGACGTCGGGG
ACGCTGTCGCCGCATGAAAAGGCCGACGTGGCCAAGGACTGA
Transcript >Ophun1|2320
ATGTCTGCCAAGAAGAGCGACGATTTCGTCGTTCGCGTCCCGGAAATCAGCCTTTCGCGCGCCGACGAGAAGCTG
CCGCTGGCCGCCGATGGCCGGTCGCCGTCGATGCTGTCGTCGGTCGAGAGCAGCGGCGGCGTCTCCGTCGCTGCC
TACTGCCTGTCGTCCATCAGCATGACGCTCGTCAACAAGTACGTCGTGTCGGGGAATCAGTGGAATCTTCATCTG
CTGTACCTGGCCATCCAGTCTATCGTTGGCACTTTCACTATCCTCGTCTGCAAGCAGGCCGGCCTCATCAAGGAT
CTCGACCCTTTTGACACGAGGAGAGCCAAGAAGTGGTTCCCCATCTCGCTACTGCTCGTCGGCATGATCTTCACG
GGAAACAAGGCGCTGCAGTTTCTGTCAGTGCCCGTCTACACCATCTTCAAGAACCTGACCATCATCGTCATTGCA
TACGGAGAGATGATGTGGTTCGGCGGCAGCGTCAGCCCGCTGAGCCTCGTCTCCTTTGTGCTAATGGTCTCGAGC
TCGATGCTGGCGGCCTGGGCCGACTTTCACAGCGTCCGGACCGATGCTTCGGGCGCTGCTCACAGGGCCGCCACG
GCCGCCGCCACGGCGACGTTGAGCACGGGCTACGCCTGGATGGGCCTCAACGTCATGTGCTCGGCGCTGTACGTG
CTGAGCATGCGCAAGGCCATCAAGATTACCAACCTCAAGAACTGGGACGTCATGTTCTACAACAATCTGCTGACC
ATTCCGGTCCTGGTCCTCTCGTCTCTCATGATAGAGGACTGGTCCGGCGCCAACCTGGCGCGCAACTTCCCGCCG
GCGACGCGCCAGAGCCTGATGATCGGCATGATCTACTCGGGCCTGGCTGCCATCTTCATCTCGTACTGCACGGCC
TGGTGCATCCGCGCCACATCGTCGACGACGTACGCCATGGCCGGCGCCCTCAACAAGCTGCCCATGGCTGTCGCC
GGCCTCGTCTTCTTCTCCGACCCCGTCACGTTTGGCAGCGTGTCGGCCATCTTCCTCGGCTTCGTCAGCGGTCTC
ATCTACACGTGGGCCAAGAACAGAAAGTCGCGACAGGCCGGTCTGCCGACGGCTGTCAGCCGCGCGACGTCGGGG
ACGCTGTCGCCGCATGAAAAGGCCGACGTGGCCAAGGACTGA
Gene >Ophun1|2320
ATGTCTGCCAAGAAGAGCGACGATTTCGTCGTTCGCGTCCCGGAAATCAGCCTTTCGCGCGCCGACGAGAAGCTG
CCGCTGGCCGCCGATGGCCGGTCGCCGTCGATGCTGTCGTCGGTCGAGAGCAGCGGCGGCGTCTCCGTCGCTGCC
TACTGCCTGTCGTCCATCAGCATGACGCTCGTCAACAAGTACGTCGTGTCGGGGAATCAGTGGAATCTTCATCTG
CTGTACCTGGCCATCCAGGTGAGTTGTCGACTCCCAAGCGCTGGCTGACGCTGCTAACGCCTTGCTCTTCAGTCT
ATCGTTGGCACTTTCACTATCCTCGTCTGCAAGCAGGCCGGCCTCATCAAGGATCTCGACCCTTTTGACACGAGG
AGAGCCAAGAAGTGTAGGTATCAACGATTCGCCGTTGTTGATCCCCCGCTGACCCCGAACGCAGGGTTCCCCATC
TCGCTACTGCTCGTCGGCATGATCTTCACGGGAAACAAGGCGCTGCAGTTTCTGTCAGTGCCCGTCTACACCATC
TTCAAGAACCTGACCATCATCGTCATTGCATACGGAGAGATGATGTGGTTCGGCGGCAGCGTCAGCCCGCTGAGC
CTCGTCTCCTTTGTGCTAATGGTCTCGAGCTCGATGCTGGCGGCCTGGGCCGACTTTCACAGCGTCCGGACCGAT
GCTTCGGGCGCTGCTCACAGGGCCGCCACGGCCGCCGCCACGGCGACGTTGAGCACGGGCTACGCCTGGATGGGC
CTCAACGTCATGTGCTCGGCGCTGTACGTGCTGAGCATGCGCAAGGCCATCAAGATTACCAACCTCAAGAACTGG
GACGGTAAGCCGGCCCGCCCTGGTGGACGGCTGCATGCTGACGATAACGAACAGTCATGTTCTACAACAATCTGC
TGACCATTCCGGTCCTGGTCCTCTCGTCTCTCATGATAGAGGACTGGTCCGGCGCCAACCTGGCGCGCAACTTCC
CGCCGGCGACGCGCCAGAGCCTGATGATCGGCATGATCTACTCGGGCCTGGCTGCCATCTTCATCTCGTACTGCA
CGGCCTGGTGCATCCGCGCCACATCGTCGACGACGTACGCCATGGCCGGCGCCCTCAACAAGCTGCCCATGGCTG
TCGCCGGCCTCGTCTTCTTCTCCGACCCCGTCACGTTTGGCAGCGTGTCGGCCATCTTCCTCGGCTTCGTCAGCG
GTCTCATCTACACGTGGGCCAAGAACAGAAAGTCGCGACAGGCCGGTCTGCCGACGGCTGTCAGCCGCGCGACGT
CGGGGACGCTGTCGCCGCATGAAAAGGCCGACGTGGCCAAGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail