Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|232
Gene name
LocationContig_105:12939..14818
Strand-
Gene length (bp)1879
Transcript length (bp)1737
Coding sequence length (bp)1737
Protein length (aa) 579

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00481 PP2C Protein phosphatase 2C 5.9E-41 187 450

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14189|PP2C5_SCHPO Protein phosphatase 2C homolog C10F6.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC10F6.17c PE=3 SV=4 138 558 9.0E-112
sp|Q12511|PDP1_YEAST [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC5 PE=1 SV=1 122 573 9.0E-103
sp|P35816|PDP1_BOVIN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Bos taurus GN=PDP1 PE=1 SV=1 132 554 2.0E-49
sp|Q3UV70|PDP1_MOUSE [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Mus musculus GN=Pdp1 PE=1 SV=1 132 554 4.0E-49
sp|Q9P0J1|PDP1_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Homo sapiens GN=PDP1 PE=1 SV=3 132 554 1.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14189|PP2C5_SCHPO Protein phosphatase 2C homolog C10F6.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC10F6.17c PE=3 SV=4 138 558 9.0E-112
sp|Q12511|PDP1_YEAST [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC5 PE=1 SV=1 122 573 9.0E-103
sp|P35816|PDP1_BOVIN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Bos taurus GN=PDP1 PE=1 SV=1 132 554 2.0E-49
sp|Q3UV70|PDP1_MOUSE [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Mus musculus GN=Pdp1 PE=1 SV=1 132 554 4.0E-49
sp|Q9P0J1|PDP1_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Homo sapiens GN=PDP1 PE=1 SV=3 132 554 1.0E-48
sp|Q5RA52|PDP1_PONAB [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Pongo abelii GN=PDP1 PE=2 SV=1 132 554 1.0E-48
sp|O88484|PDP2_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Rattus norvegicus GN=Pdp2 PE=2 SV=1 115 554 1.0E-48
sp|O88483|PDP1_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Rattus norvegicus GN=Pdp1 PE=1 SV=1 132 554 2.0E-48
sp|Q9P2J9|PDP2_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Homo sapiens GN=PDP2 PE=2 SV=2 132 559 4.0E-46
sp|Q501F9|P2C67_ARATH Probable protein phosphatase 2C 67 OS=Arabidopsis thaliana GN=At5g02760 PE=2 SV=1 196 438 2.0E-19
sp|Q9LUS8|P2C40_ARATH Probable protein phosphatase 2C 40 OS=Arabidopsis thaliana GN=At3g16560 PE=2 SV=1 194 558 3.0E-19
sp|Q5Z8P0|P2C60_ORYSJ Probable protein phosphatase 2C 60 OS=Oryza sativa subsp. japonica GN=Os06g0717800 PE=2 SV=1 196 454 2.0E-17
sp|Q9FKX4|P2C79_ARATH Probable protein phosphatase 2C 79 OS=Arabidopsis thaliana GN=At5g66080 PE=2 SV=1 196 454 6.0E-17
sp|Q5PNS9|P2C64_ARATH Probable protein phosphatase 2C 64 OS=Arabidopsis thaliana GN=At4g38520 PE=2 SV=1 196 454 8.0E-17
sp|Q9LHJ9|P2C38_ARATH Probable protein phosphatase 2C 38 OS=Arabidopsis thaliana GN=At3g12620 PE=2 SV=1 196 438 8.0E-17
sp|Q9SD12|P2C46_ARATH Probable protein phosphatase 2C 46 OS=Arabidopsis thaliana GN=At3g51370 PE=2 SV=1 196 438 2.0E-16
sp|Q7XHN8|P2C61_ORYSJ Probable protein phosphatase 2C 61 OS=Oryza sativa subsp. japonica GN=Os07g0114000 PE=2 SV=1 198 440 5.0E-16
sp|Q7XUC5|P2C43_ORYSJ Probable protein phosphatase 2C 43 OS=Oryza sativa subsp. japonica GN=Os04g0584300 PE=3 SV=2 196 454 8.0E-16
sp|Q8H063|P2C29_ORYSJ Probable protein phosphatase 2C 29 OS=Oryza sativa subsp. japonica GN=Os03g0207400 PE=2 SV=1 198 438 9.0E-16
sp|Q7XVF9|P2C39_ORYSJ Probable protein phosphatase 2C 39 OS=Oryza sativa subsp. japonica GN=Os04g0403701 PE=2 SV=2 283 558 1.0E-15
sp|Q10S32|P2C28_ORYSJ Probable protein phosphatase 2C 28 OS=Oryza sativa subsp. japonica GN=Os03g0137200 PE=2 SV=1 196 438 2.0E-15
sp|Q0V7V2|P2C42_ARATH Probable protein phosphatase 2C 42 OS=Arabidopsis thaliana GN=At3g17090 PE=2 SV=1 196 447 2.0E-15
sp|Q9ZV25|P2C23_ARATH Probable protein phosphatase 2C 23 OS=Arabidopsis thaliana GN=PLL4 PE=2 SV=1 194 449 2.0E-15
sp|Q9XGZ9|P2C72_ARATH Probable protein phosphatase 2C 72 OS=Arabidopsis thaliana GN=At5g26010 PE=2 SV=2 190 438 3.0E-15
sp|Q7Y138|P2C36_ORYSJ Probable protein phosphatase 2C 36 OS=Oryza sativa subsp. japonica GN=Os03g0832400 PE=2 SV=1 278 447 4.0E-15
sp|Q6ZHC8|P2C25_ORYSJ Probable protein phosphatase 2C 25 OS=Oryza sativa subsp. japonica GN=Os02g0685600 PE=2 SV=1 196 440 4.0E-15
sp|Q9LQN6|P2C04_ARATH Probable protein phosphatase 2C 4 OS=Arabidopsis thaliana GN=PLL5 PE=2 SV=1 194 449 5.0E-15
sp|Q9LNW3|P2C03_ARATH Protein phosphatase 2C 3 OS=Arabidopsis thaliana GN=AIP1 PE=1 SV=1 194 446 6.0E-15
sp|P35813|PPM1A_HUMAN Protein phosphatase 1A OS=Homo sapiens GN=PPM1A PE=1 SV=1 143 444 9.0E-15
sp|P35815|PPM1B_RAT Protein phosphatase 1B OS=Rattus norvegicus GN=Ppm1b PE=2 SV=1 192 444 1.0E-14
sp|Q2QN36|P2C78_ORYSJ Probable protein phosphatase 2C 78 OS=Oryza sativa subsp. japonica GN=Os12g0580900 PE=2 SV=1 196 440 1.0E-14
sp|P35814|PPM1A_RABIT Protein phosphatase 1A OS=Oryctolagus cuniculus GN=PPM1A PE=2 SV=1 143 444 1.0E-14
sp|Q94CL8|P2C48_ARATH Probable protein phosphatase 2C 48 OS=Arabidopsis thaliana GN=PP2C6 PE=2 SV=1 196 454 1.0E-14
sp|P20650|PPM1A_RAT Protein phosphatase 1A OS=Rattus norvegicus GN=Ppm1a PE=1 SV=1 143 444 1.0E-14
sp|P49443|PPM1A_MOUSE Protein phosphatase 1A OS=Mus musculus GN=Ppm1a PE=1 SV=1 143 444 2.0E-14
sp|O62829|PPM1A_BOVIN Protein phosphatase 1A OS=Bos taurus GN=PPM1A PE=2 SV=1 143 444 2.0E-14
sp|Q9SR24|P2C36_ARATH Probable protein phosphatase 2C 36 OS=Arabidopsis thaliana GN=PLL3 PE=2 SV=1 280 444 2.0E-14
sp|P36993|PPM1B_MOUSE Protein phosphatase 1B OS=Mus musculus GN=Ppm1b PE=1 SV=1 193 444 2.0E-14
sp|Q84JD5|P2C68_ARATH Probable protein phosphatase 2C 68 OS=Arabidopsis thaliana GN=At5g06750 PE=2 SV=1 195 440 4.0E-14
sp|A3AZ89|P2C46_ORYSJ Putative protein phosphatase 2C 46 OS=Oryza sativa subsp. japonica GN=Os05g0111800 PE=3 SV=2 194 455 5.0E-14
sp|O62830|PPM1B_BOVIN Protein phosphatase 1B OS=Bos taurus GN=PPM1B PE=2 SV=2 193 443 6.0E-14
sp|Q94H98|P2C34_ORYSJ Probable protein phosphatase 2C 34 OS=Oryza sativa subsp. japonica GN=BIPP2C2 PE=2 SV=1 198 440 2.0E-13
sp|Q5MFV5|P2C34_ORYSI Probable protein phosphatase 2C 34 OS=Oryza sativa subsp. indica GN=BIPP2C2 PE=2 SV=2 198 440 2.0E-13
sp|O82637|P2C61_ARATH Probable protein phosphatase 2C 61 OS=Arabidopsis thaliana GN=At4g32950 PE=3 SV=1 196 463 2.0E-13
sp|O81760|P2C63_ARATH Probable protein phosphatase 2C 63 OS=Arabidopsis thaliana GN=At4g33920 PE=2 SV=1 173 440 3.0E-13
sp|Q5JJY4|P2C04_ORYSJ Protein kinase and PP2C-like domain-containing protein OS=Oryza sativa subsp. japonica GN=Os01g0541900 PE=2 SV=1 192 438 4.0E-13
sp|Q9ZW21|P2C24_ARATH Probable protein phosphatase 2C 24 OS=Arabidopsis thaliana GN=At2g29380 PE=2 SV=1 196 437 8.0E-13
sp|Q7XCJ7|P2C72_ORYSJ Probable protein phosphatase 2C 72 OS=Oryza sativa subsp. japonica GN=Os10g0544900 PE=2 SV=1 198 438 1.0E-12
sp|Q6ZGY0|P2C26_ORYSJ Probable protein phosphatase 2C 26 OS=Oryza sativa subsp. japonica GN=Os02g0690500 PE=2 SV=1 280 443 2.0E-12
sp|Q0D673|P2C62_ORYSJ Probable protein phosphatase 2C 62 OS=Oryza sativa subsp. japonica GN=Os07g0507000 PE=2 SV=1 159 454 2.0E-12
sp|Q9XEE8|P2C30_ARATH Probable protein phosphatase 2C 30 OS=Arabidopsis thaliana GN=PP2C5 PE=2 SV=1 169 438 2.0E-12
sp|Q5N9N2|P2C09_ORYSJ Probable protein phosphatase 2C 9 OS=Oryza sativa subsp. japonica GN=Os01g0846300 PE=2 SV=1 190 438 2.0E-12
sp|Q9LZ86|P2C66_ARATH Probable protein phosphatase 2C 66 OS=Arabidopsis thaliana GN=PLL2 PE=2 SV=1 280 465 2.0E-12
sp|Q9FG61|P2C74_ARATH Probable protein phosphatase 2C 74 OS=Arabidopsis thaliana GN=At5g36250 PE=1 SV=1 193 440 3.0E-12
sp|O75688|PPM1B_HUMAN Protein phosphatase 1B OS=Homo sapiens GN=PPM1B PE=1 SV=1 193 443 4.0E-12
sp|P49598|P2C37_ARATH Protein phosphatase 2C 37 OS=Arabidopsis thaliana GN=PP2CA PE=1 SV=1 188 450 6.0E-12
sp|Q7XU84|P2C42_ORYSJ Probable protein phosphatase 2C 42 OS=Oryza sativa subsp. japonica GN=Os04g0500900 PE=3 SV=4 189 438 6.0E-12
sp|Q84T94|P2C35_ORYSJ Protein phosphatase 2C 35 OS=Oryza sativa subsp. japonica GN=XB15 PE=1 SV=1 280 442 8.0E-12
sp|Q9FIF5|P2C78_ARATH Probable protein phosphatase 2C 78 OS=Arabidopsis thaliana GN=At5g59220 PE=2 SV=1 181 438 9.0E-12
sp|Q65XK7|P2C51_ORYSJ Probable protein phosphatase 2C 51 OS=Oryza sativa subsp. japonica GN=Os05g0572700 PE=2 SV=1 185 432 2.0E-11
sp|Q9FXE4|P2C14_ARATH Probable protein phosphatase 2C 14 OS=Arabidopsis thaliana GN=At1g67820 PE=2 SV=2 196 454 2.0E-11
sp|Q8RWN7|P2C32_ARATH Protein phosphatase 2C 32 OS=Arabidopsis thaliana GN=POL PE=1 SV=2 318 443 3.0E-11
sp|Q8RX37|P2C02_ARATH Probable protein phosphatase 2C 2 OS=Arabidopsis thaliana GN=At1g07160 PE=2 SV=1 133 457 5.0E-11
sp|Q10NB9|P2C31_ORYSJ Probable protein phosphatase 2C 31 OS=Oryza sativa subsp. japonica GN=Os03g0275100 PE=2 SV=1 281 445 7.0E-11
sp|P93006|P2C27_ARATH Probable protein phosphatase 2C 27 OS=Arabidopsis thaliana GN=At2g33700 PE=2 SV=1 196 455 9.0E-11
sp|P49444|PP2C1_PARTE Protein phosphatase 2C 1 OS=Paramecium tetraurelia GN=GSPATT00029903001 PE=1 SV=2 189 442 1.0E-10
sp|O82302|P2C29_ARATH Protein phosphatase 2C 29 OS=Arabidopsis thaliana GN=PLL1 PE=1 SV=2 318 437 1.0E-10
sp|Q9H0C8|ILKAP_HUMAN Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Homo sapiens GN=ILKAP PE=1 SV=1 196 443 1.0E-10
sp|Q9Z1Z6|ILKAP_RAT Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Rattus norvegicus GN=Ilkap PE=2 SV=1 196 443 1.0E-10
sp|Q8R0F6|ILKAP_MOUSE Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Mus musculus GN=Ilkap PE=1 SV=1 196 443 1.0E-10
sp|Q9SZ53|P2C60_ARATH Probable protein phosphatase 2C 60 OS=Arabidopsis thaliana GN=At4g31860 PE=2 SV=1 196 446 2.0E-10
sp|Q7XW27|P2C38_ORYSJ Probable protein phosphatase 2C 38 OS=Oryza sativa subsp. japonica GN=Os04g0321800 PE=2 SV=2 249 463 2.0E-10
sp|Q0IIF0|ILKAP_BOVIN Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Bos taurus GN=ILKAP PE=2 SV=1 196 443 2.0E-10
sp|Q2R637|P2C75_ORYSJ Probable protein phosphatase 2C 75 OS=Oryza sativa subsp. japonica GN=Os11g0417400 PE=2 SV=1 193 456 3.0E-10
sp|Q6Z8B9|P2C12_ORYSJ Probable protein phosphatase 2C 12 OS=Oryza sativa subsp. japonica GN=Os02g0224100 PE=2 SV=1 277 438 3.0E-10
sp|Q09172|PP2C2_SCHPO Protein phosphatase 2C homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc2 PE=3 SV=1 196 447 3.0E-10
sp|Q6L4R7|P2C53_ORYSJ Probable protein phosphatase 2C 53 OS=Oryza sativa subsp. japonica GN=Os05g0592800 PE=2 SV=1 170 435 4.0E-10
sp|Q0J2L7|P2C68_ORYSJ Probable protein phosphatase 2C 68 OS=Oryza sativa subsp. japonica GN=Os09g0325700 PE=2 SV=2 185 432 4.0E-10
sp|O04719|P2C77_ARATH Protein phosphatase 2C 77 OS=Arabidopsis thaliana GN=ABI2 PE=1 SV=1 196 442 4.0E-10
sp|O81716|P2C21_ARATH Probable protein phosphatase 2C 21 OS=Arabidopsis thaliana GN=PPC4-2 PE=1 SV=1 196 446 4.0E-10
sp|Q65XG6|P2C49_ORYSJ Probable protein phosphatase 2C 49 OS=Oryza sativa subsp. japonica GN=Os05g0457200 PE=3 SV=1 196 448 5.0E-10
sp|Q8RXV3|P2C59_ARATH Probable protein phosphatase 2C 59 OS=Arabidopsis thaliana GN=WIN2 PE=1 SV=1 196 455 5.0E-10
sp|Q2QWE3|P2C77_ORYSJ Probable protein phosphatase 2C 77 OS=Oryza sativa subsp. japonica GN=Os12g0198200 PE=3 SV=1 196 433 6.0E-10
sp|Q8LAY8|P2C69_ARATH Probable protein phosphatase 2C 69 OS=Arabidopsis thaliana GN=At5g10740 PE=2 SV=1 196 438 1.0E-09
sp|Q4PSE8|P2C71_ARATH Probable protein phosphatase 2C 71 OS=Arabidopsis thaliana GN=At5g24940 PE=2 SV=1 196 455 2.0E-09
sp|Q6AUQ4|P2C47_ORYSJ Probable protein phosphatase 2C 47 OS=Oryza sativa subsp. japonica GN=Os05g0134200 PE=2 SV=1 196 449 2.0E-09
sp|Q10MX1|P2C32_ORYSJ Probable protein phosphatase 2C 32 OS=Oryza sativa subsp. japonica GN=Os03g0292100 PE=2 SV=1 144 437 2.0E-09
sp|P34221|PP2C3_YEAST Protein phosphatase 2C homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC3 PE=1 SV=4 170 438 2.0E-09
sp|Q9LRZ4|P2C41_ARATH Probable protein phosphatase 2C 41 OS=Arabidopsis thaliana GN=At3g16800 PE=2 SV=1 190 438 3.0E-09
sp|P40371|PP2C1_SCHPO Protein phosphatase 2C homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc1 PE=2 SV=1 191 447 3.0E-09
sp|Q9S9Z7|P2C10_ARATH Probable protein phosphatase 2C 10 OS=Arabidopsis thaliana GN=At1g34750 PE=2 SV=1 151 454 3.0E-09
sp|A3A8W2|P2C21_ORYSJ Probable protein phosphatase 2C 21 OS=Oryza sativa subsp. japonica GN=Os02g0606900 PE=2 SV=2 196 438 3.0E-09
sp|P38089|PP2C4_YEAST Protein phosphatase 2C homolog 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC4 PE=1 SV=1 197 438 3.0E-09
sp|Q7XQU7|P2C41_ORYSJ Probable protein phosphatase 2C 41 OS=Oryza sativa subsp. japonica GN=Os04g0452000 PE=2 SV=2 159 457 4.0E-09
sp|Q9LMT1|P2C08_ARATH Probable protein phosphatase 2C 8 OS=Arabidopsis thaliana GN=At1g18030 PE=2 SV=2 189 443 5.0E-09
sp|Q653S3|P2C70_ORYSJ Probable protein phosphatase 2C 70 OS=Oryza sativa subsp. japonica GN=Os09g0558000 PE=2 SV=2 196 447 6.0E-09
sp|Q9CAJ0|P2C16_ARATH Protein phosphatase 2C 16 OS=Arabidopsis thaliana GN=HAB1 PE=1 SV=1 196 448 7.0E-09
sp|P49597|P2C56_ARATH Protein phosphatase 2C 56 OS=Arabidopsis thaliana GN=ABI1 PE=1 SV=2 139 442 7.0E-09
sp|Q0WRB2|P2C73_ARATH Probable protein phosphatase 2C 73 OS=Arabidopsis thaliana GN=PPC6-7 PE=2 SV=1 190 459 7.0E-09
sp|Q9FLI3|P2C75_ARATH Probable protein phosphatase 2C 75 OS=Arabidopsis thaliana GN=AHG1 PE=2 SV=1 185 432 8.0E-09
sp|Q5SN75|P2C08_ORYSJ Probable protein phosphatase 2C 8 OS=Oryza sativa subsp. japonica GN=Os01g0656200 PE=2 SV=1 196 432 1.0E-08
sp|Q9LNF4|P2C13_ARATH Probable protein phosphatase 2C 13 OS=Arabidopsis thaliana GN=At1g48040 PE=2 SV=2 166 462 1.0E-08
sp|Q6EN45|P2C13_ORYSJ Probable protein phosphatase 2C 13 OS=Oryza sativa subsp. japonica GN=Os02g0255100 PE=2 SV=1 196 437 1.0E-08
sp|A0BLX0|PP2C2_PARTE Probable protein phosphatase 2C 2 OS=Paramecium tetraurelia GN=GSPATT00030171001 PE=3 SV=1 189 438 1.0E-08
sp|Q3EAF9|P2C49_ARATH Probable protein phosphatase 2C 49 OS=Arabidopsis thaliana GN=At3g62260 PE=2 SV=1 196 448 1.0E-08
sp|Q8VZN9|P2C11_ARATH Probable protein phosphatase 2C 11 OS=Arabidopsis thaliana GN=At1g43900 PE=2 SV=1 196 447 1.0E-08
sp|A0BQL0|PP2C3_PARTE Probable protein phosphatase 2C 3 OS=Paramecium tetraurelia GN=GSPATT00031056001 PE=3 SV=1 189 438 1.0E-08
sp|Q9M9W9|P2C34_ARATH Probable protein phosphatase 2C 34 OS=Arabidopsis thaliana GN=At3g05640 PE=2 SV=1 135 459 1.0E-08
sp|Q9LME4|P2C09_ARATH Probable protein phosphatase 2C 9 OS=Arabidopsis thaliana GN=At1g22280 PE=1 SV=1 154 454 1.0E-08
sp|Q53Q11|P2C74_ORYSJ Probable protein phosphatase 2C 74 OS=Oryza sativa subsp. japonica GN=Os11g0242200 PE=3 SV=1 196 438 2.0E-08
sp|Q9SD02|P2C47_ARATH Probable protein phosphatase 2C 47 OS=Arabidopsis thaliana GN=At3g51470 PE=1 SV=1 196 457 2.0E-08
sp|O80871|P2C25_ARATH Probable protein phosphatase 2C 25 OS=Arabidopsis thaliana GN=At2g30020 PE=1 SV=1 192 437 2.0E-08
sp|Q0JLP9|P2C06_ORYSJ Probable protein phosphatase 2C 6 OS=Oryza sativa subsp. japonica GN=Os01g0583100 PE=1 SV=1 196 442 2.0E-08
sp|Q9FYN7|P2C02_ORYSJ Probable protein phosphatase 2C 2 OS=Oryza sativa subsp. japonica GN=Os01g0295700 PE=2 SV=1 196 449 2.0E-08
sp|Q0JAA0|P2C44_ORYSJ Probable protein phosphatase 2C 44 OS=Oryza sativa subsp. japonica GN=Os04g0609600 PE=2 SV=1 138 454 2.0E-08
sp|P49596|PP2C2_CAEEL Probable protein phosphatase 2C T23F11.1 OS=Caenorhabditis elegans GN=ppm-2 PE=3 SV=2 196 438 3.0E-08
sp|P49595|PP2C1_CAEEL Probable protein phosphatase 2C F42G9.1 OS=Caenorhabditis elegans GN=F42G9.1 PE=3 SV=2 282 438 3.0E-08
sp|Q940A2|P2C31_ARATH Protein kinase and PP2C-like domain-containing protein OS=Arabidopsis thaliana GN=At2g40860/At2g40870 PE=2 SV=1 196 438 4.0E-08
sp|Q5JKN1|P2C05_ORYSJ Probable protein phosphatase 2C 5 OS=Oryza sativa subsp. japonica GN=Os01g0552300 PE=2 SV=1 196 438 5.0E-08
sp|Q6ETK3|P2C11_ORYSJ Probable protein phosphatase 2C 11 OS=Oryza sativa subsp. japonica GN=Os02g0180000 PE=2 SV=1 294 447 6.0E-08
sp|Q5Z6F5|P2C59_ORYSJ Probable protein phosphatase 2C 59 OS=Oryza sativa subsp. japonica GN=Os06g0698300 PE=2 SV=1 196 447 6.0E-08
sp|Q67UP9|P2C58_ORYSJ Probable protein phosphatase 2C 58 OS=Oryza sativa subsp. japonica GN=Os06g0651600 PE=2 SV=1 282 447 7.0E-08
sp|Q61074|PPM1G_MOUSE Protein phosphatase 1G OS=Mus musculus GN=Ppm1g PE=1 SV=3 282 442 8.0E-08
sp|Q7K4Q5|Y0417_DROME Probable protein phosphatase CG10417 OS=Drosophila melanogaster GN=CG10417 PE=1 SV=1 282 438 8.0E-08
sp|Q84JI0|P2C30_ORYSJ Probable protein phosphatase 2C 30 OS=Oryza sativa subsp. japonica GN=Os03g0268600 PE=2 SV=1 196 438 8.0E-08
sp|F1LNI5|PPM1G_RAT Protein phosphatase 1G OS=Rattus norvegicus GN=Ppm1g PE=1 SV=2 282 442 9.0E-08
sp|Q4R4V2|PPM1G_MACFA Protein phosphatase 1G OS=Macaca fascicularis GN=PPM1G PE=2 SV=1 282 442 9.0E-08
sp|Q6L5H6|P2C50_ORYSJ Probable protein phosphatase 2C 50 OS=Oryza sativa subsp. japonica GN=Os05g0537400 PE=3 SV=1 196 433 9.0E-08
sp|O15355|PPM1G_HUMAN Protein phosphatase 1G OS=Homo sapiens GN=PPM1G PE=1 SV=1 282 442 1.0E-07
sp|P79126|PPM1G_BOVIN Protein phosphatase 1G OS=Bos taurus GN=PPM1G PE=2 SV=2 282 442 1.0E-07
sp|Q6L5C4|P2C52_ORYSJ Probable protein phosphatase 2C 52 OS=Oryza sativa subsp. japonica GN=Os05g0587100 PE=2 SV=1 196 447 2.0E-07
sp|Q652Z7|P2C55_ORYSJ Probable protein phosphatase 2C 55 OS=Oryza sativa subsp. japonica GN=Os06g0526700 PE=2 SV=2 196 448 3.0E-07
sp|Q6L482|P2C48_ORYSJ Probable protein phosphatase 2C 48 OS=Oryza sativa subsp. japonica GN=Os05g0358500 PE=2 SV=1 175 459 3.0E-07
sp|P49599|P2C57_ARATH Protein phosphatase 2C 57 OS=Arabidopsis thaliana GN=PPH1 PE=1 SV=2 189 438 4.0E-07
sp|Q6K5I0|P2C20_ORYSJ Probable protein phosphatase 2C 20 OS=Oryza sativa subsp. japonica GN=Os02g0600000 PE=3 SV=2 196 435 4.0E-07
sp|Q69QZ0|P2C27_ORYSJ Probable protein phosphatase 2C 27 OS=Oryza sativa subsp. japonica GN=Os02g0799000 PE=2 SV=1 196 446 4.0E-07
sp|P39966|PP2C2_YEAST Protein phosphatase 2C homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC2 PE=1 SV=1 196 438 6.0E-07
sp|O64583|P2C28_ARATH Probable protein phosphatase 2C 28 OS=Arabidopsis thaliana GN=At2g34740 PE=2 SV=2 259 447 7.0E-07
sp|Q8BGL1|PPM1N_MOUSE Probable protein phosphatase 1N OS=Mus musculus GN=Ppm1n PE=2 SV=1 194 479 1.0E-06
sp|Q67UX7|P2C10_ORYSJ Probable protein phosphatase 2C 10 OS=Oryza sativa subsp. japonica GN=Os02g0149800 PE=2 SV=1 196 438 3.0E-06
sp|Q0DBU3|P2C56_ORYSJ Probable protein phosphatase 2C 56 OS=Oryza sativa subsp. japonica GN=Os06g0526800 PE=3 SV=2 196 448 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004722 protein serine/threonine phosphatase activity Yes
GO:0004721 phosphoprotein phosphatase activity No
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:0042578 phosphoric ester hydrolase activity No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016791 phosphatase activity No
GO:0016788 hydrolase activity, acting on ester bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 50 72 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|232
MHRAALGALRTTSKYFGAARHVARARLTTRRLRLPVPPDAAPLPLRSSMYFRRLPALLISGIVIGYGAWYSLNDT
DGRFGSFTSSTQAFTSQQTGRSVLVIGDDELTQATVIGDRPISKATTEDGQKVVDMLTPEQATRKLRREEKSFSV
NRGQGVTRYDLVQLASNDPIEDDHAEQIIQFPARKGEQDASRDWMFWGVYDGHSGWTTSATLRRSLISYVARELN
NTYMAAKNDSPSAEAVDLAIKTGFNRLDHDIVHKSVEKVFKSNSKPVAAGLLQPALSGSCALLSFYDSRTKLLRV
ACTGDSRAVLGRRSESGKWTASALSEDQTGSTPSEAARMRREHPGEEYVVRNGRVLGGLEPTRAFGDAVYKWSRE
VAGKLRENFFGRSPSPLLKTPPYVTAEPVVTTTRIDPDKGDFLVLATDGLWEMLTNEEVVGLVGKWIEAQSAPDE
GTSQFRKAWANVFGFPAKPLPVEEQQSRDGGQGQKTPIRLLQWGVSPDAKDRFTVRDNNVATHLVRNALGGNDNE
LLRALLTLPAPFSRRYRDDLTVQVIFFGNGEKTGDVTLNLDATYEPDPPKAEL*
Coding >Ophun1|232
ATGCACCGCGCTGCCCTTGGGGCCCTCCGAACGACGTCGAAGTACTTCGGCGCCGCAAGGCACGTGGCCCGCGCA
CGCTTGACGACGCGTCGCCTCCGACTGCCCGTGCCGCCTGACGCTGCTCCGTTGCCTCTCCGGTCTTCCATGTAT
TTCCGCAGGCTGCCAGCCCTCCTCATCTCGGGCATCGTCATCGGCTACGGCGCCTGGTACTCGCTCAACGACACC
GACGGCCGCTTCGGGAGCTTCACGTCCTCAACGCAGGCCTTTACCTCTCAGCAAACGGGACGCAGTGTGCTCGTC
ATTGGCGATGACGAGCTGACGCAGGCCACCGTCATTGGCGACAGGCCCATCTCGAAGGCTACGACCGAGGACGGA
CAGAAGGTCGTCGATATGTTGACGCCCGAGCAGGCCACGCGGAAGCTGCGTCGGGAGGAGAAGTCCTTCTCCGTC
AACCGGGGCCAGGGCGTCACCCGCTACGATTTGGTCCAGTTGGCGAGCAACGATCCCATTGAGGATGACCATGCG
GAGCAGATTATTCAGTTTCCAGCTCGTAAGGGCGAGCAGGACGCGTCACGGGACTGGATGTTTTGGGGTGTTTAC
GATGGCCATTCAGGATGGACCACGTCCGCCACTCTGCGCAGGAGTCTCATCAGCTATGTCGCCAGGGAGCTCAAC
AATACCTATATGGCCGCCAAGAATGATTCGCCGTCCGCTGAAGCCGTCGACTTGGCCATCAAGACGGGCTTCAAC
AGGCTAGACCACGACATCGTCCACAAGAGCGTCGAAAAGGTCTTCAAATCCAACTCCAAGCCCGTGGCCGCCGGC
TTACTGCAACCCGCCTTGTCCGGCTCGTGTGCCCTCCTGTCCTTCTACGACAGCAGAACCAAGCTCCTGCGCGTG
GCCTGCACTGGCGACTCGCGTGCCGTGCTGGGCCGCCGCTCAGAGTCTGGCAAGTGGACGGCTTCAGCGCTGTCT
GAGGACCAGACGGGCAGCACGCCAAGTGAGGCAGCACGGATGCGCCGCGAACACCCCGGAGAGGAATACGTCGTC
CGCAACGGCCGGGTCCTCGGCGGCTTGGAGCCGACGCGAGCATTTGGAGATGCCGTGTACAAGTGGAGCAGGGAA
GTGGCCGGCAAGCTGCGCGAGAATTTCTTTGGCCGCAGCCCGTCGCCGTTGCTCAAGACGCCACCTTATGTCACG
GCCGAGCCCGTGGTGACGACGACGCGCATCGACCCCGACAAGGGCGACTTCCTCGTCCTCGCAACCGACGGTCTG
TGGGAGATGCTCACCAACGAAGAAGTTGTCGGCCTGGTTGGGAAGTGGATCGAGGCCCAGTCCGCTCCTGACGAG
GGCACTTCACAATTCCGCAAGGCCTGGGCCAACGTTTTCGGCTTCCCTGCGAAGCCGCTCCCCGTCGAAGAGCAG
CAGTCGCGCGATGGCGGCCAAGGGCAAAAGACGCCCATCCGTCTGTTGCAGTGGGGGGTCAGTCCAGATGCCAAG
GATCGCTTCACCGTCCGCGACAACAATGTGGCCACGCATCTCGTCCGCAACGCCCTCGGAGGCAATGACAACGAG
CTGCTCCGCGCTCTGCTCACCCTTCCGGCGCCTTTTTCGCGGAGATATCGTGATGACCTCACTGTTCAGGTCATC
TTCTTCGGCAACGGCGAGAAGACAGGCGATGTGACGCTCAACCTCGACGCCACGTACGAGCCAGACCCGCCCAAG
GCCGAGCTCTAG
Transcript >Ophun1|232
ATGCACCGCGCTGCCCTTGGGGCCCTCCGAACGACGTCGAAGTACTTCGGCGCCGCAAGGCACGTGGCCCGCGCA
CGCTTGACGACGCGTCGCCTCCGACTGCCCGTGCCGCCTGACGCTGCTCCGTTGCCTCTCCGGTCTTCCATGTAT
TTCCGCAGGCTGCCAGCCCTCCTCATCTCGGGCATCGTCATCGGCTACGGCGCCTGGTACTCGCTCAACGACACC
GACGGCCGCTTCGGGAGCTTCACGTCCTCAACGCAGGCCTTTACCTCTCAGCAAACGGGACGCAGTGTGCTCGTC
ATTGGCGATGACGAGCTGACGCAGGCCACCGTCATTGGCGACAGGCCCATCTCGAAGGCTACGACCGAGGACGGA
CAGAAGGTCGTCGATATGTTGACGCCCGAGCAGGCCACGCGGAAGCTGCGTCGGGAGGAGAAGTCCTTCTCCGTC
AACCGGGGCCAGGGCGTCACCCGCTACGATTTGGTCCAGTTGGCGAGCAACGATCCCATTGAGGATGACCATGCG
GAGCAGATTATTCAGTTTCCAGCTCGTAAGGGCGAGCAGGACGCGTCACGGGACTGGATGTTTTGGGGTGTTTAC
GATGGCCATTCAGGATGGACCACGTCCGCCACTCTGCGCAGGAGTCTCATCAGCTATGTCGCCAGGGAGCTCAAC
AATACCTATATGGCCGCCAAGAATGATTCGCCGTCCGCTGAAGCCGTCGACTTGGCCATCAAGACGGGCTTCAAC
AGGCTAGACCACGACATCGTCCACAAGAGCGTCGAAAAGGTCTTCAAATCCAACTCCAAGCCCGTGGCCGCCGGC
TTACTGCAACCCGCCTTGTCCGGCTCGTGTGCCCTCCTGTCCTTCTACGACAGCAGAACCAAGCTCCTGCGCGTG
GCCTGCACTGGCGACTCGCGTGCCGTGCTGGGCCGCCGCTCAGAGTCTGGCAAGTGGACGGCTTCAGCGCTGTCT
GAGGACCAGACGGGCAGCACGCCAAGTGAGGCAGCACGGATGCGCCGCGAACACCCCGGAGAGGAATACGTCGTC
CGCAACGGCCGGGTCCTCGGCGGCTTGGAGCCGACGCGAGCATTTGGAGATGCCGTGTACAAGTGGAGCAGGGAA
GTGGCCGGCAAGCTGCGCGAGAATTTCTTTGGCCGCAGCCCGTCGCCGTTGCTCAAGACGCCACCTTATGTCACG
GCCGAGCCCGTGGTGACGACGACGCGCATCGACCCCGACAAGGGCGACTTCCTCGTCCTCGCAACCGACGGTCTG
TGGGAGATGCTCACCAACGAAGAAGTTGTCGGCCTGGTTGGGAAGTGGATCGAGGCCCAGTCCGCTCCTGACGAG
GGCACTTCACAATTCCGCAAGGCCTGGGCCAACGTTTTCGGCTTCCCTGCGAAGCCGCTCCCCGTCGAAGAGCAG
CAGTCGCGCGATGGCGGCCAAGGGCAAAAGACGCCCATCCGTCTGTTGCAGTGGGGGGTCAGTCCAGATGCCAAG
GATCGCTTCACCGTCCGCGACAACAATGTGGCCACGCATCTCGTCCGCAACGCCCTCGGAGGCAATGACAACGAG
CTGCTCCGCGCTCTGCTCACCCTTCCGGCGCCTTTTTCGCGGAGATATCGTGATGACCTCACTGTTCAGGTCATC
TTCTTCGGCAACGGCGAGAAGACAGGCGATGTGACGCTCAACCTCGACGCCACGTACGAGCCAGACCCGCCCAAG
GCCGAGCTCTAG
Gene >Ophun1|232
ATGCACCGCGCTGCCCTTGGGGCCCTCCGAACGACGTCGAAGTACTTCGGCGCCGCAAGGCACGTGGCCCGCGCA
CGCTTGACGACGCGTCGCCTCCGACTGCCCGTGCCGCCTGACGCTGCTCCGTTGCCTCTCCGGTCTTCCATGTAT
TTCCGCAGGCTGCCAGCCCTCCTCATCTCGGGCATCGTCATCGGCTACGGCGCCTGGTACTCGCTCAACGACACC
GACGGCCGCTTCGGGAGCTTCACGTCCTCAACGCAGGCCTTTACCTCTCAGCAAACGGGACGCAGTGTGCTCGTC
ATTGGCGATGACGAGCTGACGCAGGCCACCGTCATTGGCGACAGGCCCATCTCGAAGGCTACGACCGAGGACGGA
CAGAAGGTCGTCGATATGTTGACGCCCGAGCAGGCCACGCGGAAGCTGCGTCGGGAGGAGAAGTCCTTCTCCGTC
AACCGGGGCCAGGGCGTCACCCGCTACGATTTGGTCCAGTTGGCGAGCAACGATCCCATTGAGGATGACCATGCG
GAGCAGATTATTCAGTTTCCAGCTCGTAAGGGCGAGCAGGACGCGTCACGGGACTGGATGTTTTGGGGTGTTTAC
GATGGCCATTCGTAAGTTGTGCTCTGGCCATGGTGATGATGTGCATTGCCCTCAACCCTAACCTATTCTTCTCTG
CTCTACAGAGGATGGACCACGTCCGCCACTCTGCGCAGGAGTCTCATCAGCTATGTCGCCAGGGAGCTCAACAAT
ACCTATATGGCCGCCAAGAATGATTCGCCGTCCGCTGAAGCCGTCGACTTGGCCATCAAGACGGGCTTCAACAGG
CTAGACCACGACATCGTCCACAAGAGCGTCGAAAAGGTCTTCAAATCCAACTCCAAGCCCGTGGCCGCCGGCTTA
CTGCAACCCGCCTTGTCCGGCTCGTGTGCCCTCCTGTCCTTCTACGACAGCAGAACCAAGCTCCTGCGCGTGGCC
TGCACTGGCGACTCGCGTGCCGTGCTGGGCCGCCGCTCAGAGTCTGGCAAGTGGACGGCTTCAGCGCTGTCTGAG
GACCAGACGGGCAGCACGCCAAGTGAGGCAGCACGGATGCGCCGCGAACACCCCGGAGAGGAATACGTCGTCCGC
AACGGCCGGGTCCTCGGCGGCTTGGAGCCGACGCGAGCATTTGGAGATGCCGTGTACAAGTGGAGCAGGGAAGTG
GCCGGCAAGCTGCGCGAGAATTTCTTTGGCCGCAGCCCGTCGCCGTTGCTCAAGACGCCACCTTATGTCACGGCC
GAGCCCGTGGTGACGACGACGCGCATCGACCCCGACAAGGGCGACTTCCTCGTCCTCGCAACCGACGGTCTGTGG
GAGATGCTCACCAACGAAGAAGTTGTCGGCCTGGTTGGGAAGTGGATCGAGGCCCAGTCCGCTCCTGACGAGGGC
ACTTCACAATTCCGCAAGGCCTGGGCCAACGTTTTCGGCTTCCCTGCGAAGCCGCTCCCCGTCGAAGAGCAGCAG
TCGCGCGATGGCGGCCAAGGGCAAAAGACGCCCATCCGTCTGTTGCAGTGGGGGGTCAGTCCAGATGCCAAGGAT
CGCTTCACCGTCCGCGACAACAATGTGGCCACGCATCTCGTCCGCAACGCCCTCGGAGGCAATGACAACGAGCTG
CTCCGCGCTCTGCTCACCCTTCCGGCGCCTTTTTCGCGGAGATATCGGTGAGTCTAGGAACCATGGGGACCGTCC
GTCTCGTTATTGAGCGGTTGTTGACTGGCCATCTCATATCAGTGATGACCTCACTGTTCAGGTCATCTTCTTCGG
CAACGGCGAGAAGACAGGCGATGTGACGCTCAACCTCGACGCCACGTACGAGCCAGACCCGCCCAAGGCCGAGCT
CTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail