Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2313
Gene name
LocationContig_212:10728..12729
Strand-
Gene length (bp)2001
Transcript length (bp)1890
Coding sequence length (bp)1890
Protein length (aa) 630

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03062 MBOAT MBOAT, membrane-bound O-acyltransferase family 2.9E-44 252 536

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53154|GUP1_YEAST Glycerol uptake protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUP1 PE=1 SV=1 38 629 6.0E-151
sp|Q09758|YA71_SCHPO Putative membrane-bound O-acyltransferase C24H6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.01c PE=3 SV=4 50 629 9.0E-134
sp|Q08929|GUP2_YEAST Glycerol uptake protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUP2 PE=3 SV=1 40 629 1.0E-129
sp|Q5VTY9|HHAT_HUMAN Protein-cysteine N-palmitoyltransferase HHAT OS=Homo sapiens GN=HHAT PE=1 SV=1 320 513 2.0E-10
sp|Q8BMT9|HHAT_MOUSE Protein-cysteine N-palmitoyltransferase HHAT OS=Mus musculus GN=Hhat PE=2 SV=1 317 523 4.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.5

Transmembrane Domains

Domain # Start End Length
1 48 70 22
2 160 182 22
3 194 216 22
4 331 353 22
5 374 393 19
6 403 425 22
7 494 516 22
8 520 542 22
9 555 577 22
10 592 614 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2313
MDTARFLAKVYDPDTLDTRFTTSSSVPYETVVDGRRREREGKASAPPVLTLEFCLYHLIVWMVVPYMFWVTYDVS
RPSDPRYAKYERYLSPGWILGRKVDVSDAQYHTFRRNVPFMAGFLVCHPLLRLAWNAFNRKPKTSSLALGGTARL
LERVSFDYYFAILFLVILHGVSALKVLAILYINYRIAKGLPRRFVPAATWAFNIAILFANDIYHGYRLEPVAARF
AAADSNLVHWAGWLDGHGGLMARWEVLFNISVLRLISFNMDYYWSFEGRHAESLEVRSAKPSTPFTSSDAPAQRR
KKKQLDRANLSEKERISTGAEPGDYSFRNYVAYAVYAPLYLAGPILTFNDYVAQSRHRAASIETARTLRYGLRFL
LALLVMEVVLHIDYVGAIAKANPDWSSYTPAQLSILSLFNLHVIWLKLLLPWRLFRLWALVDGIDPPENMVRCVS
NNYSTQLFWRAWHRSYNRWLIRYLYGPLIGYPMAVKGPGGRWRSVARAVMTYLTVFTFVALWHDIQMRLLIWGWL
IVVFMLPEWTAVWLFPRRLWESRPVKYRLLCGIGGVMNVLLMMSANLVGFAVGLDGLQSIIRGIFRDWSGFVFLL
TACSCLFVGVQVMFRVREKEMKRGVTLRC*
Coding >Ophun1|2313
ATGGACACGGCCCGCTTCCTGGCCAAGGTCTACGACCCAGACACGCTCGACACGCGCTTCACCACCTCGTCATCG
GTCCCCTACGAGACTGTCGTCGATGGCCGTCGTCGAGAGCGCGAGGGCAAGGCGTCGGCTCCGCCAGTGCTGACG
CTCGAGTTTTGCCTATATCATCTCATCGTATGGATGGTTGTGCCGTACATGTTCTGGGTCACCTATGATGTCTCC
AGACCTTCCGATCCCCGGTATGCCAAGTACGAGCGCTACCTATCGCCCGGCTGGATCCTCGGACGCAAGGTCGAC
GTTTCGGACGCGCAGTATCACACCTTTCGGCGGAATGTGCCCTTCATGGCTGGCTTCCTCGTCTGCCATCCGCTG
CTGAGGCTGGCCTGGAACGCCTTCAACCGGAAACCCAAAACGTCTTCGCTGGCTTTGGGCGGTACGGCGCGGCTG
CTCGAGCGCGTCTCGTTCGATTACTACTTTGCCATCCTGTTCCTCGTCATTCTCCACGGCGTATCGGCCCTGAAG
GTGCTGGCCATTCTGTACATCAACTACCGCATTGCAAAGGGTCTACCCAGGCGCTTCGTGCCGGCTGCTACTTGG
GCCTTTAACATTGCCATTCTCTTCGCCAACGACATCTACCATGGATACCGTCTCGAGCCCGTGGCTGCTCGGTTT
GCTGCCGCCGACTCGAATCTCGTTCACTGGGCTGGCTGGCTCGACGGCCACGGTGGGCTCATGGCCCGGTGGGAG
GTGCTGTTCAACATCAGCGTCTTGCGTCTCATCAGCTTCAACATGGACTACTACTGGAGCTTCGAAGGCCGCCAC
GCCGAATCTCTCGAGGTACGCTCCGCCAAGCCCTCTACCCCCTTCACCTCTTCCGACGCCCCGGCTCAAAGGCGC
AAAAAGAAGCAGCTGGATCGGGCCAACCTGTCGGAAAAGGAGCGCATCTCGACCGGGGCCGAGCCCGGCGACTAT
AGCTTCCGCAACTACGTCGCCTACGCCGTCTACGCGCCTCTCTACCTAGCCGGGCCGATCCTGACCTTTAACGAC
TACGTGGCTCAGTCGAGGCACCGGGCGGCCAGCATCGAGACGGCTCGAACGCTACGGTACGGCCTACGCTTTCTG
CTGGCCCTGCTGGTCATGGAGGTGGTGCTTCACATCGACTACGTGGGCGCCATCGCAAAGGCCAACCCGGACTGG
AGCAGCTACACGCCCGCGCAGCTGAGCATCCTGTCGCTCTTTAACCTGCACGTCATCTGGCTCAAGCTGTTGCTG
CCGTGGCGTCTGTTCCGCCTCTGGGCTCTCGTCGACGGCATCGACCCGCCCGAGAACATGGTGCGGTGCGTCAGC
AACAACTACAGCACCCAGCTCTTCTGGCGCGCCTGGCACCGCTCCTACAACCGCTGGCTGATCCGCTACCTGTAC
GGGCCTCTCATCGGCTACCCCATGGCCGTCAAGGGGCCGGGGGGACGGTGGCGTTCGGTGGCCCGCGCCGTCATG
ACCTACCTGACCGTCTTCACCTTTGTCGCCCTCTGGCACGATATCCAGATGCGGCTGCTCATCTGGGGCTGGCTC
ATTGTCGTCTTCATGCTGCCCGAGTGGACGGCGGTGTGGCTGTTTCCTCGCCGGCTGTGGGAGTCGCGGCCGGTG
AAGTATCGTCTTCTGTGCGGCATCGGGGGCGTCATGAACGTGCTTCTCATGATGTCGGCCAACCTCGTCGGCTTT
GCTGTTGGGCTGGACGGGCTGCAGAGCATCATCCGCGGGATATTCCGTGACTGGTCTGGCTTCGTCTTCCTGTTG
ACGGCCTGCTCGTGCCTCTTCGTCGGGGTGCAGGTTATGTTTCGGGTGCGCGAGAAGGAGATGAAAAGGGGCGTG
ACGCTCAGGTGCTGA
Transcript >Ophun1|2313
ATGGACACGGCCCGCTTCCTGGCCAAGGTCTACGACCCAGACACGCTCGACACGCGCTTCACCACCTCGTCATCG
GTCCCCTACGAGACTGTCGTCGATGGCCGTCGTCGAGAGCGCGAGGGCAAGGCGTCGGCTCCGCCAGTGCTGACG
CTCGAGTTTTGCCTATATCATCTCATCGTATGGATGGTTGTGCCGTACATGTTCTGGGTCACCTATGATGTCTCC
AGACCTTCCGATCCCCGGTATGCCAAGTACGAGCGCTACCTATCGCCCGGCTGGATCCTCGGACGCAAGGTCGAC
GTTTCGGACGCGCAGTATCACACCTTTCGGCGGAATGTGCCCTTCATGGCTGGCTTCCTCGTCTGCCATCCGCTG
CTGAGGCTGGCCTGGAACGCCTTCAACCGGAAACCCAAAACGTCTTCGCTGGCTTTGGGCGGTACGGCGCGGCTG
CTCGAGCGCGTCTCGTTCGATTACTACTTTGCCATCCTGTTCCTCGTCATTCTCCACGGCGTATCGGCCCTGAAG
GTGCTGGCCATTCTGTACATCAACTACCGCATTGCAAAGGGTCTACCCAGGCGCTTCGTGCCGGCTGCTACTTGG
GCCTTTAACATTGCCATTCTCTTCGCCAACGACATCTACCATGGATACCGTCTCGAGCCCGTGGCTGCTCGGTTT
GCTGCCGCCGACTCGAATCTCGTTCACTGGGCTGGCTGGCTCGACGGCCACGGTGGGCTCATGGCCCGGTGGGAG
GTGCTGTTCAACATCAGCGTCTTGCGTCTCATCAGCTTCAACATGGACTACTACTGGAGCTTCGAAGGCCGCCAC
GCCGAATCTCTCGAGGTACGCTCCGCCAAGCCCTCTACCCCCTTCACCTCTTCCGACGCCCCGGCTCAAAGGCGC
AAAAAGAAGCAGCTGGATCGGGCCAACCTGTCGGAAAAGGAGCGCATCTCGACCGGGGCCGAGCCCGGCGACTAT
AGCTTCCGCAACTACGTCGCCTACGCCGTCTACGCGCCTCTCTACCTAGCCGGGCCGATCCTGACCTTTAACGAC
TACGTGGCTCAGTCGAGGCACCGGGCGGCCAGCATCGAGACGGCTCGAACGCTACGGTACGGCCTACGCTTTCTG
CTGGCCCTGCTGGTCATGGAGGTGGTGCTTCACATCGACTACGTGGGCGCCATCGCAAAGGCCAACCCGGACTGG
AGCAGCTACACGCCCGCGCAGCTGAGCATCCTGTCGCTCTTTAACCTGCACGTCATCTGGCTCAAGCTGTTGCTG
CCGTGGCGTCTGTTCCGCCTCTGGGCTCTCGTCGACGGCATCGACCCGCCCGAGAACATGGTGCGGTGCGTCAGC
AACAACTACAGCACCCAGCTCTTCTGGCGCGCCTGGCACCGCTCCTACAACCGCTGGCTGATCCGCTACCTGTAC
GGGCCTCTCATCGGCTACCCCATGGCCGTCAAGGGGCCGGGGGGACGGTGGCGTTCGGTGGCCCGCGCCGTCATG
ACCTACCTGACCGTCTTCACCTTTGTCGCCCTCTGGCACGATATCCAGATGCGGCTGCTCATCTGGGGCTGGCTC
ATTGTCGTCTTCATGCTGCCCGAGTGGACGGCGGTGTGGCTGTTTCCTCGCCGGCTGTGGGAGTCGCGGCCGGTG
AAGTATCGTCTTCTGTGCGGCATCGGGGGCGTCATGAACGTGCTTCTCATGATGTCGGCCAACCTCGTCGGCTTT
GCTGTTGGGCTGGACGGGCTGCAGAGCATCATCCGCGGGATATTCCGTGACTGGTCTGGCTTCGTCTTCCTGTTG
ACGGCCTGCTCGTGCCTCTTCGTCGGGGTGCAGGTTATGTTTCGGGTGCGCGAGAAGGAGATGAAAAGGGGCGTG
ACGCTCAGGTGCTGA
Gene >Ophun1|2313
ATGGACACGGCCCGCTTCCTGGCCAAGGTCTACGACCCAGACACGCTCGACACGCGCTTCACCACCTCGTCATCG
GTCCCCTACGAGACTGTCGTCGATGGCCGTCGTCGAGAGCGCGAGGGCAAGGCGTCGGCTCCGCCAGTGCTGACG
CTCGAGTTTTGCCTATATCATCTCATCGTATGGATGGTTGTGCCGTACATGTTCTGGGTCACCTATGATGTCTCC
AGACGTTCGTCTCTCTCTCTCTCCATCTCTCGTCATGGTCTGGCTGACGTCTGGATAGCTTCCGATCCCCGGTAT
GCCAAGTACGAGCGCTACCTATCGCCCGGCTGGATCCTCGGACGCAAGGTCGACGTTTCGGACGCGCAGTATCAC
ACCTTTCGGCGGAATGTGCCCTTCATGGCTGGCTTCCTCGTCTGCCATCCGCTGCTGAGGCTGGCCTGGAACGCC
TTCAACCGGAAACCCAAAACGTCTTCGCTGGCTTTGGGCGGTACGGCGCGGCTGCTCGAGCGCGTCTCGTTCGAT
TACTACTTTGCCATCCTGTTCCTCGTCATTCTCCACGGCGTATCGGCCCTGAAGGTGCTGGCCATTCTGTACATC
AACTACCGCATTGCAAAGGGTCTACCCAGGCGCTTCGTGCCGGCTGCTACTTGGGCCTTTAACATTGCCATTCTC
TTCGCCAACGACATCTACCATGGATACCGTCTCGAGCCCGTGGCTGCTCGGTTTGCTGCCGCCGACTCGAATCTC
GTTCACTGGGCTGGCTGGCTCGACGGCCACGGTGGGCTCATGGCCCGGTGGGAGGTGCTGTTCAACATCAGCGTC
TTGCGTCTCATCAGCTTCAACATGGACTACTACTGGAGCTTCGAAGGCCGCCACGCCGAATCTCTCGAGGTACGC
TCCGCCAAGCCCTCTACCCCCTTCACCTCTTCCGACGCCCCGGCTCAAAGGCGCAAAAAGAAGCAGCTGGATCGG
GCCAACCTGTCGGAAAAGGAGCGCATCTCGACCGGGGCCGAGCCCGGCGACTATAGCTTCCGCAACTACGTCGCC
TACGCCGTCTACGCGCCTCTCTACCTAGCCGGGCCGATCCTGACCTTTAACGACTACGTGGCTCAGTCGAGGCAC
CGGGCGGCCAGCATCGAGACGGCTCGAACGCTACGGTACGGCCTACGCTTTCTGCTGGCCCTGCTGGTCATGGAG
GTGGTGCTTCACATCGACTACGTGGGCGCCATCGCAAAGGCCAACCCGGACTGGAGCAGCTACACGCCCGCGCAG
CTGAGCATCCTGTCGCTCTTTAACCTGCACGTCATCTGGCTCAAGCTGTTGCTGCCGTGGCGTCTGTTCCGCCTC
TGGGCTCTCGTCGACGGCATCGACCCGCCCGAGAACATGGTGCGGTGCGTCAGCAACAACTACAGCACCCAGCTC
TTCTGGCGCGCCTGGCACCGCTCCTACAACCGCTGGCTGATCCGCTACCTGTACGGGCCTCTCATCGGCTACCCC
ATGGCCGTCAAGGGGCCGGGGGGACGGTGGCGTTCGGTGGCCCGCGCCGTCATGACCTACCTGACCGTCTTCACC
TTTGTCGCCCTCTGGCACGATATCCAGATGCGGCTGCTCATCTGGGGCTGGCTCATTGTCGTCTTCATGCTGCCC
GAGTGGACGGCGGTGTGGCTGTTTCCTCGCCGGCTGTGGGAGTCGCGGCCGGTGAAGTATCGTCTTCTGTGCGGC
ATCGGGGGCGTCATGAACGTGCTTCTCATGATGTCGGCCAACCTCGTCGGCTTTGCTGTTGGGCTGGACGGGCTG
CAGAGCATCATCCGCGGGATATTCCGTGACTGGTCTGGTGAGGACGACGTCTACCCTTGGTACGGGGTGGAGAAA
GACTTGCTAACTTTTACAGGCTTCGTCTTCCTGTTGACGGCCTGCTCGTGCCTCTTCGTCGGGGTGCAGGTTATG
TTTCGGGTGCGCGAGAAGGAGATGAAAAGGGGCGTGACGCTCAGGTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail