Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2306
Gene name
LocationContig_2108:80..866
Strand-
Gene length (bp)786
Transcript length (bp)786
Coding sequence length (bp)786
Protein length (aa) 262

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40015|ISC1_YEAST Inositol phosphosphingolipids phospholipase C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISC1 PE=1 SV=1 3 250 4.0E-19
sp|O74369|CSS1_SCHPO Inositol phosphosphingolipids phospholipase C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=css1 PE=1 SV=2 1 250 5.0E-19

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

Domain # Start End Length
1 181 200 19
2 210 232 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2306
MDPLSLPHRIITSRAPVNDLWRLIHPHSALGPPQPDTPVPSARFNLTVNGATSDGPYNTWRWSKDAQKSLRAGRQ
PPTVDPHAPDPKGKRLDYIFASLGPNSPWAVKSVAVTMTDPHPELSVSLSDHFAVSATLRRRSPTDDESDQAYND
ETSLPLSAYDEILAHIDTYTARERAQRRYRALHFYAALVVWATILVAAWFAPQRFAPFLLALVASLVLAAGLIDG
LLSLLFFSSELRSLQEFAWEVGNARCAAASRSKLNT*
Coding >Ophun1|2306
ATGGACCCCCTCTCCCTCCCCCACCGCATCATCACCTCCCGCGCCCCCGTCAACGACCTCTGGCGCCTCATCCAC
CCGCACAGCGCCCTCGGCCCCCCCCAACCCGACACCCCCGTCCCATCCGCCCGCTTCAACCTCACCGTCAACGGC
GCCACCAGCGATGGCCCGTATAATACCTGGCGATGGTCCAAGGATGCTCAGAAGAGCCTCCGCGCAGGCCGCCAA
CCCCCTACCGTCGATCCCCACGCTCCAGACCCCAAGGGCAAGCGACTGGACTACATCTTCGCCTCCCTCGGCCCC
AACTCGCCATGGGCCGTCAAGTCCGTCGCCGTCACCATGACAGACCCCCATCCCGAACTATCCGTCTCCCTATCA
GATCACTTCGCCGTCAGCGCCACCCTCCGCCGACGCTCCCCCACCGACGACGAATCCGACCAAGCCTACAACGAC
GAAACCTCCCTCCCCCTATCCGCCTACGACGAGATCCTCGCCCACATCGACACCTACACCGCCCGCGAGCGCGCC
CAACGCCGATACCGCGCCTTGCACTTTTACGCCGCCCTCGTCGTCTGGGCCACCATCCTCGTCGCTGCCTGGTTC
GCCCCCCAACGCTTCGCCCCCTTCCTGCTCGCCCTCGTCGCAAGCCTCGTCCTGGCCGCCGGTCTGATCGACGGC
CTGCTCTCCCTGCTCTTCTTCTCGTCCGAGCTGCGCAGCCTCCAAGAGTTCGCGTGGGAAGTTGGCAACGCCAGA
TGCGCCGCCGCCAGTCGCTCCAAGCTCAACACGTAG
Transcript >Ophun1|2306
ATGGACCCCCTCTCCCTCCCCCACCGCATCATCACCTCCCGCGCCCCCGTCAACGACCTCTGGCGCCTCATCCAC
CCGCACAGCGCCCTCGGCCCCCCCCAACCCGACACCCCCGTCCCATCCGCCCGCTTCAACCTCACCGTCAACGGC
GCCACCAGCGATGGCCCGTATAATACCTGGCGATGGTCCAAGGATGCTCAGAAGAGCCTCCGCGCAGGCCGCCAA
CCCCCTACCGTCGATCCCCACGCTCCAGACCCCAAGGGCAAGCGACTGGACTACATCTTCGCCTCCCTCGGCCCC
AACTCGCCATGGGCCGTCAAGTCCGTCGCCGTCACCATGACAGACCCCCATCCCGAACTATCCGTCTCCCTATCA
GATCACTTCGCCGTCAGCGCCACCCTCCGCCGACGCTCCCCCACCGACGACGAATCCGACCAAGCCTACAACGAC
GAAACCTCCCTCCCCCTATCCGCCTACGACGAGATCCTCGCCCACATCGACACCTACACCGCCCGCGAGCGCGCC
CAACGCCGATACCGCGCCTTGCACTTTTACGCCGCCCTCGTCGTCTGGGCCACCATCCTCGTCGCTGCCTGGTTC
GCCCCCCAACGCTTCGCCCCCTTCCTGCTCGCCCTCGTCGCAAGCCTCGTCCTGGCCGCCGGTCTGATCGACGGC
CTGCTCTCCCTGCTCTTCTTCTCGTCCGAGCTGCGCAGCCTCCAAGAGTTCGCGTGGGAAGTTGGCAACGCCAGA
TGCGCCGCCGCCAGTCGCTCCAAGCTCAACACGTAG
Gene >Ophun1|2306
ATGGACCCCCTCTCCCTCCCCCACCGCATCATCACCTCCCGCGCCCCCGTCAACGACCTCTGGCGCCTCATCCAC
CCGCACAGCGCCCTCGGCCCCCCCCAACCCGACACCCCCGTCCCATCCGCCCGCTTCAACCTCACCGTCAACGGC
GCCACCAGCGATGGCCCGTATAATACCTGGCGATGGTCCAAGGATGCTCAGAAGAGCCTCCGCGCAGGCCGCCAA
CCCCCTACCGTCGATCCCCACGCTCCAGACCCCAAGGGCAAGCGACTGGACTACATCTTCGCCTCCCTCGGCCCC
AACTCGCCATGGGCCGTCAAGTCCGTCGCCGTCACCATGACAGACCCCCATCCCGAACTATCCGTCTCCCTATCA
GATCACTTCGCCGTCAGCGCCACCCTCCGCCGACGCTCCCCCACCGACGACGAATCCGACCAAGCCTACAACGAC
GAAACCTCCCTCCCCCTATCCGCCTACGACGAGATCCTCGCCCACATCGACACCTACACCGCCCGCGAGCGCGCC
CAACGCCGATACCGCGCCTTGCACTTTTACGCCGCCCTCGTCGTCTGGGCCACCATCCTCGTCGCTGCCTGGTTC
GCCCCCCAACGCTTCGCCCCCTTCCTGCTCGCCCTCGTCGCAAGCCTCGTCCTGGCCGCCGGTCTGATCGACGGC
CTGCTCTCCCTGCTCTTCTTCTCGTCCGAGCTGCGCAGCCTCCAAGAGTTCGCGTGGGAAGTTGGCAACGCCAGA
TGCGCCGCCGCCAGTCGCTCCAAGCTCAACACGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail