Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2300
Gene name
LocationContig_210:18863..21698
Strand-
Gene length (bp)2835
Transcript length (bp)2724
Coding sequence length (bp)2724
Protein length (aa) 908

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04615 Utp14 Utp14 protein 1.8E-181 243 905

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87137|YDM6_SCHPO Uncharacterized protein C57A7.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A7.06 PE=1 SV=1 291 905 4.0E-53
sp|Q04500|UTP14_YEAST U3 small nucleolar RNA-associated protein 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP14 PE=1 SV=1 758 906 3.0E-29
sp|Q3T0Q8|UT14A_BOVIN U3 small nucleolar RNA-associated protein 14 homolog A OS=Bos taurus GN=UTP14A PE=2 SV=1 758 902 9.0E-21
sp|Q640M1|UT14A_MOUSE U3 small nucleolar RNA-associated protein 14 homolog A OS=Mus musculus GN=Utp14a PE=1 SV=1 758 903 4.0E-20
sp|Q6EJB6|UT14B_MOUSE U3 small nucleolar RNA-associated protein 14 homolog B OS=Mus musculus GN=Utp14b PE=1 SV=2 708 902 6.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87137|YDM6_SCHPO Uncharacterized protein C57A7.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A7.06 PE=1 SV=1 291 905 4.0E-53
sp|Q04500|UTP14_YEAST U3 small nucleolar RNA-associated protein 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP14 PE=1 SV=1 758 906 3.0E-29
sp|Q3T0Q8|UT14A_BOVIN U3 small nucleolar RNA-associated protein 14 homolog A OS=Bos taurus GN=UTP14A PE=2 SV=1 758 902 9.0E-21
sp|Q640M1|UT14A_MOUSE U3 small nucleolar RNA-associated protein 14 homolog A OS=Mus musculus GN=Utp14a PE=1 SV=1 758 903 4.0E-20
sp|Q6EJB6|UT14B_MOUSE U3 small nucleolar RNA-associated protein 14 homolog B OS=Mus musculus GN=Utp14b PE=1 SV=2 708 902 6.0E-20
sp|Q9BVJ6|UT14A_HUMAN U3 small nucleolar RNA-associated protein 14 homolog A OS=Homo sapiens GN=UTP14A PE=1 SV=1 761 902 2.0E-19
sp|Q5TAP6|UT14C_HUMAN U3 small nucleolar RNA-associated protein 14 homolog C OS=Homo sapiens GN=UTP14C PE=1 SV=1 758 902 1.0E-18
sp|Q3T0Q8|UT14A_BOVIN U3 small nucleolar RNA-associated protein 14 homolog A OS=Bos taurus GN=UTP14A PE=2 SV=1 257 515 2.0E-15
sp|Q6EJB6|UT14B_MOUSE U3 small nucleolar RNA-associated protein 14 homolog B OS=Mus musculus GN=Utp14b PE=1 SV=2 290 518 4.0E-10
sp|Q9BVJ6|UT14A_HUMAN U3 small nucleolar RNA-associated protein 14 homolog A OS=Homo sapiens GN=UTP14A PE=1 SV=1 213 515 8.0E-10
sp|Q640M1|UT14A_MOUSE U3 small nucleolar RNA-associated protein 14 homolog A OS=Mus musculus GN=Utp14a PE=1 SV=1 257 515 7.0E-09
sp|Q5TAP6|UT14C_HUMAN U3 small nucleolar RNA-associated protein 14 homolog C OS=Homo sapiens GN=UTP14C PE=1 SV=1 213 518 4.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2300
MPGRQAHGRPLLAAQKAKSSSKKSKARSHKNALDAFGIALERFPSRQTKTPRARQLDAETESERKHGRNEDGGME
EEDVDDEPKRKKSKASSGAVREDAGEHGSDSEGNEWMMGGLASGHEDSEIESDDAFGESDDDKFQGYTFRGSKPK
KDETDDSEGDSDDEEGETLGADAIDLATALDQFEEDDSEEPKGDEKSGSEESGDDESEVSGESESEDGDEEADDK
QLEAMRGLVSEYAGEGAEEGKAHQSGSKRKIGVGELGLASIDDPILKRSVKLMTKEAKEKRPGAAKKLDVPLPKR
QQDRQDRAVAYEKTKETLDRWTETVKQNRRADHLIFPLPQNSATAGLDTTEMQTLTTKSATNELESTIMSIMDQS
ELSMQKQKQSKSKPQEFDDEGKLLSRKEAIKKRRMQREVMEREAKRAKRIKKIKSKAYHRVHRRQKERDEMAAKE
AMEEAGEIDSEAEREAQDRRRALERVGQRHKESRWAKMGAKTKRAVWDDDFRQGLTEMARKDEELRRRKEGKKGD
AEASDSDASSGSGDDSDDDDDDKLRRRLDKLEAQGAEEPTSGLMSMKFMQKAETARKKANDDLVRQIRRELDGED
ETAGSEGETEVKDVGRRRFGGSGPVKTSRPVLDTPKRTARGEDTSREEGDAGLTTRDDEACEFVLSGEPASTAGA
WSRGEARRSKIKGRVEELDVVSTTLIAKEASKTNPKAKASNRTKSKPHDDASNQPPTHDSDTSSTSSSDTDTDTD
PTPNPGSQHALLTRAFASDAIATAFALEKSATQAADADKTIDTTLPGWGSWVGDGVSERDKSRHRHRFLTHIPGV
KMEERRDAKLDKVIINEKRVKKNDAYLASHLPHPFESREQYERSLRLPIGPEWLTKSSFTQSVKPRVLMKQGVIA
PMSKPMV*
Coding >Ophun1|2300
ATGCCGGGACGACAAGCCCACGGTCGGCCTCTGCTAGCAGCGCAGAAAGCGAAATCATCGAGCAAGAAATCCAAG
GCGAGATCGCACAAAAATGCCCTCGATGCGTTCGGCATCGCGCTAGAACGCTTCCCCTCGAGACAAACGAAGACG
CCGAGGGCGAGGCAGTTGGATGCCGAGACCGAGAGCGAGCGGAAACACGGCAGAAATGAAGATGGCGGGATGGAA
GAAGAAGACGTCGATGACGAGCCCAAGAGGAAGAAGTCAAAGGCCTCATCCGGAGCCGTCCGCGAGGATGCTGGC
GAGCATGGAAGTGACAGCGAAGGAAATGAGTGGATGATGGGGGGTTTAGCTTCGGGGCACGAAGACTCTGAAATT
GAAAGCGATGACGCATTCGGCGAAAGCGACGACGACAAGTTTCAGGGCTACACATTCCGTGGATCAAAGCCGAAA
AAGGACGAGACGGACGACTCCGAAGGCGATTCGGATGACGAGGAGGGGGAGACGCTCGGTGCGGATGCCATAGAT
CTCGCCACGGCGCTCGACCAGTTCGAAGAGGACGACAGCGAGGAGCCGAAAGGTGATGAGAAGTCAGGGTCTGAA
GAGTCGGGCGACGACGAATCTGAAGTATCGGGCGAATCCGAGAGCGAAGACGGAGATGAAGAGGCCGACGACAAA
CAGCTCGAGGCCATGCGAGGCCTGGTGTCAGAGTACGCCGGCGAGGGAGCCGAAGAGGGCAAGGCCCATCAGTCA
GGCTCGAAGCGAAAGATTGGGGTCGGCGAGCTCGGCCTGGCCAGCATCGACGACCCGATCCTGAAGAGGTCGGTG
AAGCTGATGACCAAGGAGGCAAAGGAGAAGCGGCCGGGAGCGGCCAAGAAGCTCGACGTACCCTTGCCGAAGAGG
CAGCAGGATCGCCAGGATCGAGCCGTGGCCTACGAGAAGACGAAGGAGACGCTGGACCGGTGGACGGAGACGGTG
AAGCAGAACCGGAGAGCGGATCATCTTATATTTCCCCTGCCCCAGAATTCGGCGACGGCCGGCCTCGACACGACA
GAGATGCAAACATTGACCACCAAGAGTGCCACCAACGAGCTCGAGTCCACCATCATGTCCATCATGGATCAAAGC
GAGCTGTCTATGCAGAAGCAGAAGCAGAGCAAGTCCAAGCCTCAAGAATTCGACGACGAGGGCAAGCTACTCTCA
CGCAAGGAGGCCATCAAGAAGCGGCGAATGCAGAGAGAAGTAATGGAGAGAGAAGCCAAGCGAGCGAAACGAATC
AAGAAGATCAAGAGCAAGGCATACCACCGCGTGCACCGCAGACAGAAGGAACGCGACGAGATGGCAGCCAAGGAA
GCCATGGAAGAGGCGGGCGAGATCGACTCAGAGGCGGAACGAGAGGCTCAAGACCGTCGACGTGCCCTGGAACGT
GTGGGACAGCGACACAAGGAAAGCAGATGGGCCAAAATGGGGGCCAAGACGAAGCGCGCCGTCTGGGATGACGAC
TTCCGGCAGGGTCTGACGGAGATGGCACGGAAAGACGAGGAGCTTCGTCGGCGCAAGGAGGGGAAGAAGGGTGAC
GCGGAGGCTTCCGACTCGGACGCGAGCAGCGGCTCAGGAGACGACTCTGACGATGACGACGACGACAAGCTGCGT
CGTCGACTGGACAAGCTCGAAGCTCAAGGCGCAGAGGAGCCCACGTCAGGACTGATGAGCATGAAGTTTATGCAA
AAGGCGGAAACGGCCAGGAAGAAGGCCAACGACGACCTTGTCCGTCAAATCCGACGAGAACTCGACGGAGAAGAC
GAAACCGCCGGCTCCGAAGGCGAAACAGAAGTCAAGGATGTAGGCCGCAGACGCTTCGGCGGTTCGGGCCCCGTC
AAGACATCACGACCCGTCCTGGATACCCCCAAGCGGACAGCGAGAGGAGAGGACACGTCGAGAGAAGAGGGCGAC
GCTGGCTTGACGACGAGGGATGACGAGGCGTGTGAGTTTGTGCTTTCCGGTGAGCCGGCTTCTACAGCCGGTGCC
TGGTCTCGAGGCGAGGCGCGACGCAGCAAGATCAAGGGGAGAGTTGAGGAGCTGGACGTTGTTTCTACAACCCTG
ATAGCCAAAGAGGCATCAAAGACCAACCCCAAAGCCAAAGCCAGCAACAGAACCAAGTCCAAACCCCACGACGAC
GCCAGCAACCAACCGCCAACCCACGACTCCGACACCAGCAGCACCTCCTCCTCAGACACAGACACAGACACGGAT
CCAACCCCCAACCCCGGAAGCCAACACGCCCTCCTAACCCGCGCCTTCGCCTCCGACGCCATAGCCACCGCCTTC
GCCCTCGAAAAATCCGCCACCCAAGCCGCCGACGCCGACAAAACCATCGACACCACCCTCCCCGGCTGGGGTTCC
TGGGTAGGCGACGGCGTCAGCGAGCGGGACAAGAGCCGCCATCGCCACCGCTTCCTCACCCACATCCCCGGCGTG
AAGATGGAGGAGCGGAGGGACGCGAAGCTGGACAAGGTGATAATCAACGAGAAGCGCGTCAAGAAGAACGACGCC
TATCTCGCCTCTCACCTCCCCCACCCCTTCGAGTCGCGAGAGCAGTACGAGCGCTCGCTGCGTCTGCCCATTGGA
CCCGAGTGGCTCACCAAGAGCTCCTTCACGCAGAGCGTCAAGCCGCGCGTCTTGATGAAGCAGGGTGTTATTGCG
CCCATGTCCAAGCCCATGGTGTAA
Transcript >Ophun1|2300
ATGCCGGGACGACAAGCCCACGGTCGGCCTCTGCTAGCAGCGCAGAAAGCGAAATCATCGAGCAAGAAATCCAAG
GCGAGATCGCACAAAAATGCCCTCGATGCGTTCGGCATCGCGCTAGAACGCTTCCCCTCGAGACAAACGAAGACG
CCGAGGGCGAGGCAGTTGGATGCCGAGACCGAGAGCGAGCGGAAACACGGCAGAAATGAAGATGGCGGGATGGAA
GAAGAAGACGTCGATGACGAGCCCAAGAGGAAGAAGTCAAAGGCCTCATCCGGAGCCGTCCGCGAGGATGCTGGC
GAGCATGGAAGTGACAGCGAAGGAAATGAGTGGATGATGGGGGGTTTAGCTTCGGGGCACGAAGACTCTGAAATT
GAAAGCGATGACGCATTCGGCGAAAGCGACGACGACAAGTTTCAGGGCTACACATTCCGTGGATCAAAGCCGAAA
AAGGACGAGACGGACGACTCCGAAGGCGATTCGGATGACGAGGAGGGGGAGACGCTCGGTGCGGATGCCATAGAT
CTCGCCACGGCGCTCGACCAGTTCGAAGAGGACGACAGCGAGGAGCCGAAAGGTGATGAGAAGTCAGGGTCTGAA
GAGTCGGGCGACGACGAATCTGAAGTATCGGGCGAATCCGAGAGCGAAGACGGAGATGAAGAGGCCGACGACAAA
CAGCTCGAGGCCATGCGAGGCCTGGTGTCAGAGTACGCCGGCGAGGGAGCCGAAGAGGGCAAGGCCCATCAGTCA
GGCTCGAAGCGAAAGATTGGGGTCGGCGAGCTCGGCCTGGCCAGCATCGACGACCCGATCCTGAAGAGGTCGGTG
AAGCTGATGACCAAGGAGGCAAAGGAGAAGCGGCCGGGAGCGGCCAAGAAGCTCGACGTACCCTTGCCGAAGAGG
CAGCAGGATCGCCAGGATCGAGCCGTGGCCTACGAGAAGACGAAGGAGACGCTGGACCGGTGGACGGAGACGGTG
AAGCAGAACCGGAGAGCGGATCATCTTATATTTCCCCTGCCCCAGAATTCGGCGACGGCCGGCCTCGACACGACA
GAGATGCAAACATTGACCACCAAGAGTGCCACCAACGAGCTCGAGTCCACCATCATGTCCATCATGGATCAAAGC
GAGCTGTCTATGCAGAAGCAGAAGCAGAGCAAGTCCAAGCCTCAAGAATTCGACGACGAGGGCAAGCTACTCTCA
CGCAAGGAGGCCATCAAGAAGCGGCGAATGCAGAGAGAAGTAATGGAGAGAGAAGCCAAGCGAGCGAAACGAATC
AAGAAGATCAAGAGCAAGGCATACCACCGCGTGCACCGCAGACAGAAGGAACGCGACGAGATGGCAGCCAAGGAA
GCCATGGAAGAGGCGGGCGAGATCGACTCAGAGGCGGAACGAGAGGCTCAAGACCGTCGACGTGCCCTGGAACGT
GTGGGACAGCGACACAAGGAAAGCAGATGGGCCAAAATGGGGGCCAAGACGAAGCGCGCCGTCTGGGATGACGAC
TTCCGGCAGGGTCTGACGGAGATGGCACGGAAAGACGAGGAGCTTCGTCGGCGCAAGGAGGGGAAGAAGGGTGAC
GCGGAGGCTTCCGACTCGGACGCGAGCAGCGGCTCAGGAGACGACTCTGACGATGACGACGACGACAAGCTGCGT
CGTCGACTGGACAAGCTCGAAGCTCAAGGCGCAGAGGAGCCCACGTCAGGACTGATGAGCATGAAGTTTATGCAA
AAGGCGGAAACGGCCAGGAAGAAGGCCAACGACGACCTTGTCCGTCAAATCCGACGAGAACTCGACGGAGAAGAC
GAAACCGCCGGCTCCGAAGGCGAAACAGAAGTCAAGGATGTAGGCCGCAGACGCTTCGGCGGTTCGGGCCCCGTC
AAGACATCACGACCCGTCCTGGATACCCCCAAGCGGACAGCGAGAGGAGAGGACACGTCGAGAGAAGAGGGCGAC
GCTGGCTTGACGACGAGGGATGACGAGGCGTGTGAGTTTGTGCTTTCCGGTGAGCCGGCTTCTACAGCCGGTGCC
TGGTCTCGAGGCGAGGCGCGACGCAGCAAGATCAAGGGGAGAGTTGAGGAGCTGGACGTTGTTTCTACAACCCTG
ATAGCCAAAGAGGCATCAAAGACCAACCCCAAAGCCAAAGCCAGCAACAGAACCAAGTCCAAACCCCACGACGAC
GCCAGCAACCAACCGCCAACCCACGACTCCGACACCAGCAGCACCTCCTCCTCAGACACAGACACAGACACGGAT
CCAACCCCCAACCCCGGAAGCCAACACGCCCTCCTAACCCGCGCCTTCGCCTCCGACGCCATAGCCACCGCCTTC
GCCCTCGAAAAATCCGCCACCCAAGCCGCCGACGCCGACAAAACCATCGACACCACCCTCCCCGGCTGGGGTTCC
TGGGTAGGCGACGGCGTCAGCGAGCGGGACAAGAGCCGCCATCGCCACCGCTTCCTCACCCACATCCCCGGCGTG
AAGATGGAGGAGCGGAGGGACGCGAAGCTGGACAAGGTGATAATCAACGAGAAGCGCGTCAAGAAGAACGACGCC
TATCTCGCCTCTCACCTCCCCCACCCCTTCGAGTCGCGAGAGCAGTACGAGCGCTCGCTGCGTCTGCCCATTGGA
CCCGAGTGGCTCACCAAGAGCTCCTTCACGCAGAGCGTCAAGCCGCGCGTCTTGATGAAGCAGGGTGTTATTGCG
CCCATGTCCAAGCCCATGGTGTAA
Gene >Ophun1|2300
ATGCCGGGACGACAAGCCCACGGTCGGCCTCTGCTAGCAGCGCAGAAAGCGAAATCATCGAGCAAGAAATCCAAG
GCGAGATCGCACAAAAATGCCCTCGATGCGTTCGGCATCGCGCTAGAACGCTTCCCCTCGAGACAAACGAAGACG
CCGAGGGCGAGGCAGTTGGATGCCGAGACCGAGAGCGAGCGGAAACACGGCAGAAATGAAGATGGCGGGATGGAA
GAAGAAGACGTCGATGACGAGCCCAAGAGGAAGAAGTCAAAGGCCTCATCCGGAGCCGTCCGCGAGGATGCTGGC
GAGCATGGAAGTGACAGCGAAGGAAATGAGTGGATGATGGGGGGTTTAGCTTCGGGGCACGAAGACTCTGAAATT
GAAAGCGATGACGCATTCGGCGAAAGCGACGACGACAAGTTTCAGGGCTACACATTCCGTGGATCAAAGCCGAAA
AAGGACGAGGTCAGCGTCAATGTACGATGTCAAATCCCATACGAGGCTAACGAAGATCCAGACGGACGACTCCGA
AGGCGATTCGGATGACGAGGAGGGGGAGACGCTCGGTGCGGATGCCATAGATCTCGCCACGGCGCTCGACCAGTT
CGAAGAGGACGACAGCGAGGAGCCGAAAGGTGATGAGAAGTCAGGGTCTGAAGAGTCGGGCGACGACGAATCTGA
AGTATCGGGCGAATCCGAGAGCGAAGACGGAGATGAAGAGGCCGACGACAAACAGCTCGAGGCCATGCGAGGCCT
GGTGTCAGAGTACGCCGGCGAGGGAGCCGAAGAGGGCAAGGCCCATCAGTCAGGCTCGAAGCGAAAGATTGGGGT
CGGCGAGCTCGGCCTGGCCAGCATCGACGACCCGATCCTGAAGAGGTCGGTGAAGCTGATGACCAAGGAGGCAAA
GGAGAAGCGGCCGGGAGCGGCCAAGAAGCTCGACGTACCCTTGCCGAAGAGGCAGCAGGATCGCCAGGATCGAGC
CGTGGCCTACGAGAAGACGAAGGAGACGCTGGACCGGTGGACGGAGACGGTGAAGCAGAACCGGAGAGCGGATCA
TCTTATATTTCCCCTGCCCCAGAATTCGGCGACGGCCGGCCTCGACACGACAGAGATGCAAACATTGACCACCAA
GAGTGCCACCAACGAGCTCGAGTCCACCATCATGTCCATCATGGATCAAAGCGAGCTGTCTATGCAGAAGCAGAA
GCAGAGCAAGTCCAAGCCTCAAGAATTCGACGACGAGGGCAAGCTACTCTCACGCAAGGAGGCCATCAAGAAGCG
GCGAATGCAGAGAGAAGTAATGGAGAGAGAAGCCAAGCGAGCGAAACGAATCAAGAAGATCAAGAGCAAGGCATA
CCACCGCGTGCACCGCAGACAGAAGGAACGCGACGAGATGGCAGCCAAGGAAGCCATGGAAGAGGCGGGCGAGAT
CGACTCAGAGGCGGAACGAGAGGCTCAAGACCGTCGACGTGCCCTGGAACGTGTGGGACAGCGACACAAGGAAAG
CAGATGGGCCAAAATGGGGGCCAAGACGAAGCGCGCCGTCTGGGATGACGACTTCCGGCAGGGTCTGACGGAGAT
GGCACGGAAAGACGAGGAGCTTCGTCGGCGCAAGGAGGGGAAGAAGGGTGACGCGGAGGCTTCCGACTCGGACGC
GAGCAGCGGCTCAGGAGACGACTCTGACGATGACGACGACGACAAGCTGCGTCGTCGACTGGACAAGCTCGAAGC
TCAAGGCGCAGAGGAGCCCACGTCAGGACTGATGAGCATGAAGTTTATGCAAAAGGCGGAAACGGCCAGGAAGAA
GGCCAACGACGACCTTGTCCGTCAAATCCGACGAGAACTCGACGGAGAAGACGAAACCGCCGGCTCCGAAGGCGA
AACAGAAGTCAAGGATGTAGGCCGCAGACGCTTCGGCGGTTCGGGCCCCGTCAAGACATCACGACCCGTCCTGGA
TACCCCCAAGCGGACAGCGAGAGGAGAGGACACGTCGAGAGAAGAGGGCGACGCTGGCTTGACGACGAGGGATGA
CGAGGCGTGTGAGTTTGTGCTTTCCGGTGAGCCGGCTTCTACAGCCGGTGCCTGGTCTCGAGGCGAGGCGCGACG
CAGCAAGATCAAGGGGAGAGTTGAGGAGCTGGACGTTGTTTCTACAACCCTGATAGCCAAAGAGGCATCAAAGAC
CAACCCCAAAGCCAAAGCCAGCAACAGAACCAAGTCCAAACCCCACGACGACGCCAGCAACCAACCGCCAACCCA
CGACTCCGACACCAGCAGCACCTCCTCCTCAGACACAGACACAGACACGGATCCAACCCCCAACCCCGGAAGCCA
ACACGCCCTCCTAACCCGCGCCTTCGCCTCCGACGCCATAGCCACCGCCTTCGCCCTCGAAAAATCCGCCACCCA
AGCCGCCGACGCCGACAAAACCATCGACACCACCCTCCCCGGCTGGGGTTCCTGGGTAGGCGACGGCGTCAGCGA
GCGGGACAAGAGCCGCCATCGCCACCGCTTCCTCACCCACATCCCCGGCGTGAAGATGGAGGAGCGGAGGGACGC
GAAGCTGGACAAGGTGATAATCAACGAGAAGCGCGTCAAGAAGGTGAGTTCACAATCACATTCACAATTCACCTC
GTGGATAACCTCGGCTGATGACGTTAGAACGACGCCTATCTCGCCTCTCACCTCCCCCACCCCTTCGAGTCGCGA
GAGCAGTACGAGCGCTCGCTGCGTCTGCCCATTGGACCCGAGTGGCTCACCAAGAGCTCCTTCACGCAGAGCGTC
AAGCCGCGCGTCTTGATGAAGCAGGGTGTTATTGCGCCCATGTCCAAGCCCATGGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail