Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|230
Gene name
LocationContig_105:9185..10022
Strand-
Gene length (bp)837
Transcript length (bp)786
Coding sequence length (bp)786
Protein length (aa) 262

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01694 Rhomboid Rhomboid family 1.3E-05 44 191
PF08551 DUF1751 Eukaryotic integral membrane protein (DUF1751) 9.4E-05 46 106

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTK7|DSC2_SCHPO DSC E3 ubiquitin ligase complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dsc2 PE=1 SV=1 4 206 6.0E-27
sp|Q9LET3|RBL20_ARATH Rhomboid-like protein 20 OS=Arabidopsis thaliana GN=RBL20 PE=2 SV=1 3 196 6.0E-12
sp|Q08232|YO073_YEAST Uncharacterized membrane protein YOL073C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL073C PE=1 SV=1 4 206 1.0E-11
sp|Q8RXQ2|RBL18_ARATH Rhomboid-like protein 18 OS=Arabidopsis thaliana GN=RBL18 PE=2 SV=1 3 212 3.0E-11
sp|Q8R1K1|UBAC2_MOUSE Ubiquitin-associated domain-containing protein 2 OS=Mus musculus GN=Ubac2 PE=1 SV=1 33 169 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTK7|DSC2_SCHPO DSC E3 ubiquitin ligase complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dsc2 PE=1 SV=1 4 206 6.0E-27
sp|Q9LET3|RBL20_ARATH Rhomboid-like protein 20 OS=Arabidopsis thaliana GN=RBL20 PE=2 SV=1 3 196 6.0E-12
sp|Q08232|YO073_YEAST Uncharacterized membrane protein YOL073C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL073C PE=1 SV=1 4 206 1.0E-11
sp|Q8RXQ2|RBL18_ARATH Rhomboid-like protein 18 OS=Arabidopsis thaliana GN=RBL18 PE=2 SV=1 3 212 3.0E-11
sp|Q8R1K1|UBAC2_MOUSE Ubiquitin-associated domain-containing protein 2 OS=Mus musculus GN=Ubac2 PE=1 SV=1 33 169 2.0E-08
sp|Q8NBM4|UBAC2_HUMAN Ubiquitin-associated domain-containing protein 2 OS=Homo sapiens GN=UBAC2 PE=1 SV=1 45 169 1.0E-07
sp|Q4R910|UBAC2_MACFA Ubiquitin-associated domain-containing protein 2 OS=Macaca fascicularis GN=UBAC2 PE=2 SV=1 45 169 2.0E-07
sp|Q5ZJQ8|UBAC2_CHICK Ubiquitin-associated domain-containing protein 2 OS=Gallus gallus GN=UBAC2 PE=2 SV=1 21 169 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Yes
GO:0016021 integral component of membrane Yes
GO:0004252 serine-type endopeptidase activity Yes
GO:0051179 localization No
GO:0017171 serine hydrolase activity No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0003824 catalytic activity No
GO:0051234 establishment of localization No
GO:0048193 Golgi vesicle transport No
GO:0140096 catalytic activity, acting on a protein No
GO:0008236 serine-type peptidase activity No
GO:0008233 peptidase activity No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0004175 endopeptidase activity No
GO:0016192 vesicle-mediated transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 50 72 22
3 84 106 22
4 111 133 22
5 165 187 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|230
MTFTNAPVTQLAVLGLVSGSVLTSLFDVKHYFYILIDTHLWRYRQLWRLLAYQLCYVNSAEVLFAAMSVYNLRPV
ERMWGSRKYASFLVVSYLLTALLCPLVMVVLRPVSVGLFNYVPPGPTPVIFAVLAQFYAMVPHTYKFRVATSNDA
SSGLTLSDKSYQYIVAFHLSLLQWPGSIAGAIVGWLVGHAWRGGVLPASLVTWRLPGWMMGMGAQGGGSAEFEGL
RRRLEGEERAVSTAIQGQPGGSQVDRRRIGGGRSGG*
Coding >Ophun1|230
ATGACCTTCACAAACGCGCCCGTGACCCAGCTAGCGGTCCTGGGCCTCGTGTCCGGCTCCGTCTTGACCAGCTTG
TTCGACGTGAAGCATTACTTCTACATCCTCATCGACACCCACCTCTGGCGCTATCGCCAGCTTTGGCGGCTTCTG
GCATACCAGCTCTGCTATGTCAACTCGGCCGAGGTGCTGTTCGCCGCCATGTCTGTCTACAACCTCCGGCCCGTT
GAGCGCATGTGGGGTTCCAGGAAATACGCGTCGTTCCTCGTCGTTTCTTACCTGTTGACGGCCTTGCTGTGCCCC
CTGGTCATGGTGGTGCTGCGGCCGGTCTCGGTCGGCCTATTCAACTACGTTCCCCCGGGCCCGACGCCCGTCATC
TTCGCCGTGCTCGCCCAATTCTATGCCATGGTCCCGCACACGTACAAGTTCCGTGTGGCGACGTCCAACGACGCT
TCGTCTGGGCTTACACTGTCAGACAAGTCTTATCAATACATCGTCGCCTTCCATCTCTCCCTCCTGCAGTGGCCC
GGGTCCATCGCCGGCGCCATCGTTGGCTGGCTTGTCGGTCACGCCTGGCGTGGCGGCGTGCTGCCCGCGTCGCTC
GTGACGTGGCGGCTACCGGGCTGGATGATGGGGATGGGCGCGCAAGGGGGTGGCAGCGCCGAGTTTGAGGGTCTG
CGTCGCCGTCTTGAAGGCGAGGAGCGTGCCGTGTCTACCGCGATTCAGGGCCAGCCAGGCGGGAGTCAGGTGGAT
AGGAGGCGGATAGGAGGCGGACGATCAGGCGGATGA
Transcript >Ophun1|230
ATGACCTTCACAAACGCGCCCGTGACCCAGCTAGCGGTCCTGGGCCTCGTGTCCGGCTCCGTCTTGACCAGCTTG
TTCGACGTGAAGCATTACTTCTACATCCTCATCGACACCCACCTCTGGCGCTATCGCCAGCTTTGGCGGCTTCTG
GCATACCAGCTCTGCTATGTCAACTCGGCCGAGGTGCTGTTCGCCGCCATGTCTGTCTACAACCTCCGGCCCGTT
GAGCGCATGTGGGGTTCCAGGAAATACGCGTCGTTCCTCGTCGTTTCTTACCTGTTGACGGCCTTGCTGTGCCCC
CTGGTCATGGTGGTGCTGCGGCCGGTCTCGGTCGGCCTATTCAACTACGTTCCCCCGGGCCCGACGCCCGTCATC
TTCGCCGTGCTCGCCCAATTCTATGCCATGGTCCCGCACACGTACAAGTTCCGTGTGGCGACGTCCAACGACGCT
TCGTCTGGGCTTACACTGTCAGACAAGTCTTATCAATACATCGTCGCCTTCCATCTCTCCCTCCTGCAGTGGCCC
GGGTCCATCGCCGGCGCCATCGTTGGCTGGCTTGTCGGTCACGCCTGGCGTGGCGGCGTGCTGCCCGCGTCGCTC
GTGACGTGGCGGCTACCGGGCTGGATGATGGGGATGGGCGCGCAAGGGGGTGGCAGCGCCGAGTTTGAGGGTCTG
CGTCGCCGTCTTGAAGGCGAGGAGCGTGCCGTGTCTACCGCGATTCAGGGCCAGCCAGGCGGGAGTCAGGTGGAT
AGGAGGCGGATAGGAGGCGGACGATCAGGCGGATGA
Gene >Ophun1|230
ATGACCTTCACAAACGCGCCCGTGACCCAGCTAGCGGTCCTGGGCCTCGTGTCCGGCTCCGTCTTGACCAGCTTG
TTCGACGTGAAGCATTACTTCTACATCCTCATCGACACCCACCTCTGGCGCTATCGCCAGCTTTGGCGGCTTCTG
GCATACCAGCTCTGCTATGTCAACTCGGCCGAGGTGCTGTTCGCCGCCATGTCTGTCTACAACCTCCGGCCCGTT
GAGCGCATGTGGGGTTCCAGGAAATACGCGGTGAGTCGGCATGAGCACGCGACGCACGCCGCCAGAATTGACCGT
CTGTAGTCGTTCCTCGTCGTTTCTTACCTGTTGACGGCCTTGCTGTGCCCCCTGGTCATGGTGGTGCTGCGGCCG
GTCTCGGTCGGCCTATTCAACTACGTTCCCCCGGGCCCGACGCCCGTCATCTTCGCCGTGCTCGCCCAATTCTAT
GCCATGGTCCCGCACACGTACAAGTTCCGTGTGGCGACGTCCAACGACGCTTCGTCTGGGCTTACACTGTCAGAC
AAGTCTTATCAATACATCGTCGCCTTCCATCTCTCCCTCCTGCAGTGGCCCGGGTCCATCGCCGGCGCCATCGTT
GGCTGGCTTGTCGGTCACGCCTGGCGTGGCGGCGTGCTGCCCGCGTCGCTCGTGACGTGGCGGCTACCGGGCTGG
ATGATGGGGATGGGCGCGCAAGGGGGTGGCAGCGCCGAGTTTGAGGGTCTGCGTCGCCGTCTTGAAGGCGAGGAG
CGTGCCGTGTCTACCGCGATTCAGGGCCAGCCAGGCGGGAGTCAGGTGGATAGGAGGCGGATAGGAGGCGGACGA
TCAGGCGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail