Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2297
Gene name
LocationContig_210:11245..12183
Strand+
Gene length (bp)938
Transcript length (bp)876
Coding sequence length (bp)876
Protein length (aa) 292

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10451 Stn1 Telomere regulation protein Stn1 3.0E-15 99 227

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q0E7J7|STN1_SCHPO Protein stn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stn1 PE=1 SV=1 71 211 1.0E-14
sp|Q08DB2|STN1_BOVIN CST complex subunit STN1 OS=Bos taurus GN=OBFC1 PE=2 SV=1 66 183 1.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5598
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|574
Ophiocordyceps australis map64 (Brazil) OphauB2|435
Ophiocordyceps camponoti-rufipedis Ophun1|2297 (this protein)
Ophiocordyceps kimflemingae Ophio5|8507
Ophiocordyceps subramaniannii Hirsu2|7557

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2297
MVGWCRGGCALELALVILSDDPERAKVTRPGPAVYPISVATSPPQPPTELVLYRPCAAMSTASQYPRYCFHLSPT
FNVWCLFHAREIHRLEKYEEYEGEQFFFYGNLPIRWVRIVGVVVAIDDFDGRRVYTVDDSSGACIETLMMLQPPQ
GANSGKGRSETVDVGSVVDVKGHLCLFRDEKQIKIELIRHLRNTADEVALWERRAAFRRDVLDKSWVLSSAEIDR
CRKEANRSKAALQRRKRRRAAAVSTRGTGRRQEAHPGEGTRREVAAHVRDMILAGEMAGKYHALGL*
Coding >Ophun1|2297
ATGGTCGGCTGGTGCCGTGGTGGTTGTGCTCTGGAGTTGGCTCTCGTCATTCTCTCCGACGATCCGGAGCGGGCC
AAGGTCACGCGGCCCGGGCCCGCCGTTTATCCGATCTCGGTTGCAACCTCACCGCCGCAACCACCTACCGAACTC
GTCCTCTACCGGCCATGTGCTGCCATGAGCACAGCTTCACAGTATCCTCGTTACTGCTTCCATCTGTCGCCCACG
TTCAACGTCTGGTGTCTCTTTCACGCGCGCGAGATCCATCGCCTCGAAAAGTATGAGGAATATGAAGGAGAGCAA
TTCTTCTTTTACGGAAACTTGCCGATTCGATGGGTTCGCATAGTGGGCGTCGTCGTTGCCATCGATGACTTCGAC
GGCCGACGCGTCTACACGGTTGATGACAGCAGCGGCGCCTGCATCGAGACACTGATGATGCTGCAACCACCACAA
GGCGCCAACAGCGGGAAAGGGCGCAGCGAGACTGTCGACGTCGGATCTGTCGTCGACGTCAAGGGCCATTTGTGT
CTCTTCCGCGACGAGAAACAAATCAAGATCGAGCTCATCAGGCACCTCCGCAACACCGCTGACGAGGTGGCTCTC
TGGGAGAGGAGGGCCGCATTCCGACGCGACGTCCTCGACAAATCTTGGGTTTTATCAAGCGCCGAAATCGACCGT
TGCCGCAAGGAGGCGAATCGATCCAAGGCAGCCCTTCAGCGCAGGAAGAGACGCCGCGCTGCAGCCGTTTCGACG
AGAGGCACGGGCAGGCGACAGGAGGCTCATCCAGGCGAGGGCACGCGCCGTGAAGTGGCTGCTCATGTCCGAGAC
ATGATCCTCGCCGGGGAGATGGCAGGAAAGTACCACGCCTTGGGGCTTTGA
Transcript >Ophun1|2297
ATGGTCGGCTGGTGCCGTGGTGGTTGTGCTCTGGAGTTGGCTCTCGTCATTCTCTCCGACGATCCGGAGCGGGCC
AAGGTCACGCGGCCCGGGCCCGCCGTTTATCCGATCTCGGTTGCAACCTCACCGCCGCAACCACCTACCGAACTC
GTCCTCTACCGGCCATGTGCTGCCATGAGCACAGCTTCACAGTATCCTCGTTACTGCTTCCATCTGTCGCCCACG
TTCAACGTCTGGTGTCTCTTTCACGCGCGCGAGATCCATCGCCTCGAAAAGTATGAGGAATATGAAGGAGAGCAA
TTCTTCTTTTACGGAAACTTGCCGATTCGATGGGTTCGCATAGTGGGCGTCGTCGTTGCCATCGATGACTTCGAC
GGCCGACGCGTCTACACGGTTGATGACAGCAGCGGCGCCTGCATCGAGACACTGATGATGCTGCAACCACCACAA
GGCGCCAACAGCGGGAAAGGGCGCAGCGAGACTGTCGACGTCGGATCTGTCGTCGACGTCAAGGGCCATTTGTGT
CTCTTCCGCGACGAGAAACAAATCAAGATCGAGCTCATCAGGCACCTCCGCAACACCGCTGACGAGGTGGCTCTC
TGGGAGAGGAGGGCCGCATTCCGACGCGACGTCCTCGACAAATCTTGGGTTTTATCAAGCGCCGAAATCGACCGT
TGCCGCAAGGAGGCGAATCGATCCAAGGCAGCCCTTCAGCGCAGGAAGAGACGCCGCGCTGCAGCCGTTTCGACG
AGAGGCACGGGCAGGCGACAGGAGGCTCATCCAGGCGAGGGCACGCGCCGTGAAGTGGCTGCTCATGTCCGAGAC
ATGATCCTCGCCGGGGAGATGGCAGGAAAGTACCACGCCTTGGGGCTTTGA
Gene >Ophun1|2297
ATGGTCGGCTGGTGCCGTGGTGGTTGTGCTCTGGAGTTGGCTCTCGTCATTCTCTCCGACGATCCGGAGCGGGCC
AAGGTCACGCGGCCCGGGCCCGCCGTTTATCCGATCTCGGTTGCAACCTCACCGCCGCAACCACCTACCGAACTC
GTCCTCTACCGGCCATGTGCTGCCATGAGCACAGCTTCACAGTATCCTCGTTACTGCTTCCATCTGTCGCCCACG
TTCAACGTCTGGTGTCTCTTTCACGCGCGCGAGATCCATCGCCTCGAAAAGTATGAGGAATATGAAGGAGGTCAG
TGTCGACCGCGTCACTCGCTTGGGCGTCTCTGACACGCGCCCCCCCCCTCCCCCCAGAGCAATTCTTCTTTTACG
GAAACTTGCCGATTCGATGGGTTCGCATAGTGGGCGTCGTCGTTGCCATCGATGACTTCGACGGCCGACGCGTCT
ACACGGTTGATGACAGCAGCGGCGCCTGCATCGAGACACTGATGATGCTGCAACCACCACAAGGCGCCAACAGCG
GGAAAGGGCGCAGCGAGACTGTCGACGTCGGATCTGTCGTCGACGTCAAGGGCCATTTGTGTCTCTTCCGCGACG
AGAAACAAATCAAGATCGAGCTCATCAGGCACCTCCGCAACACCGCTGACGAGGTGGCTCTCTGGGAGAGGAGGG
CCGCATTCCGACGCGACGTCCTCGACAAATCTTGGGTTTTATCAAGCGCCGAAATCGACCGTTGCCGCAAGGAGG
CGAATCGATCCAAGGCAGCCCTTCAGCGCAGGAAGAGACGCCGCGCTGCAGCCGTTTCGACGAGAGGCACGGGCA
GGCGACAGGAGGCTCATCCAGGCGAGGGCACGCGCCGTGAAGTGGCTGCTCATGTCCGAGACATGATCCTCGCCG
GGGAGATGGCAGGAAAGTACCACGCCTTGGGGCTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail