Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2293
Gene name
LocationContig_210:33..4388
Strand-
Gene length (bp)4355
Transcript length (bp)3747
Coding sequence length (bp)3747
Protein length (aa) 1249

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02171 Piwi Piwi domain 1.5E-70 692 1002
PF08699 ArgoL1 Argonaute linker 1 domain 1.7E-09 337 367
PF16488 ArgoL2 Argonaute linker 2 domain 1.2E-08 539 584
PF02170 PAZ PAZ domain 5.4E-07 457 528

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q69UP6|AGO18_ORYSJ Protein argonaute 18 OS=Oryza sativa subsp. japonica GN=AGO18 PE=2 SV=1 92 1008 4.0E-81
sp|Q7XSA2|AGO1B_ORYSJ Protein argonaute 1B OS=Oryza sativa subsp. japonica GN=AGO1B PE=2 SV=3 135 1024 1.0E-78
sp|O04379|AGO1_ARATH Protein argonaute 1 OS=Arabidopsis thaliana GN=AGO1 PE=1 SV=1 77 1023 4.0E-78
sp|Q6EU14|AGO1A_ORYSJ Protein argonaute 1A OS=Oryza sativa subsp. japonica GN=AGO1A PE=2 SV=1 43 1019 2.0E-76
sp|Q851R2|MEL1_ORYSJ Protein argonaute MEL1 OS=Oryza sativa subsp. japonica GN=MEL1 PE=2 SV=1 136 1004 2.0E-75
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q69UP6|AGO18_ORYSJ Protein argonaute 18 OS=Oryza sativa subsp. japonica GN=AGO18 PE=2 SV=1 92 1008 4.0E-81
sp|Q7XSA2|AGO1B_ORYSJ Protein argonaute 1B OS=Oryza sativa subsp. japonica GN=AGO1B PE=2 SV=3 135 1024 1.0E-78
sp|O04379|AGO1_ARATH Protein argonaute 1 OS=Arabidopsis thaliana GN=AGO1 PE=1 SV=1 77 1023 4.0E-78
sp|Q6EU14|AGO1A_ORYSJ Protein argonaute 1A OS=Oryza sativa subsp. japonica GN=AGO1A PE=2 SV=1 43 1019 2.0E-76
sp|Q851R2|MEL1_ORYSJ Protein argonaute MEL1 OS=Oryza sativa subsp. japonica GN=MEL1 PE=2 SV=1 136 1004 2.0E-75
sp|Q9SJK3|AGO5_ARATH Protein argonaute 5 OS=Arabidopsis thaliana GN=AGO5 PE=1 SV=2 343 1004 2.0E-74
sp|Q5Z5B2|AGO1D_ORYSJ Protein argonaute 1D OS=Oryza sativa subsp. japonica GN=AGO1D PE=2 SV=1 74 1004 1.0E-73
sp|Q69VD5|PNH1_ORYSJ Protein argonaute PNH1 OS=Oryza sativa subsp. japonica GN=PHN1 PE=2 SV=1 344 1027 3.0E-72
sp|Q7Y001|AGO12_ORYSJ Protein argonaute 12 OS=Oryza sativa subsp. japonica GN=AGO12 PE=2 SV=2 343 1022 6.0E-72
sp|Q9XGW1|AGO10_ARATH Protein argonaute 10 OS=Arabidopsis thaliana GN=AGO10 PE=2 SV=1 135 1009 1.0E-71
sp|Q9QZ81|AGO2_RAT Protein argonaute-2 OS=Rattus norvegicus GN=Ago2 PE=2 SV=2 136 1004 2.0E-71
sp|Q9UKV8|AGO2_HUMAN Protein argonaute-2 OS=Homo sapiens GN=AGO2 PE=1 SV=3 136 1004 3.0E-71
sp|Q8CJG0|AGO2_MOUSE Protein argonaute-2 OS=Mus musculus GN=Ago2 PE=1 SV=3 136 1004 3.0E-71
sp|Q6QME8|AGO2_BOVIN Protein argonaute-2 OS=Bos taurus GN=AGO2 PE=2 SV=1 136 1004 4.0E-71
sp|Q6K972|AGO1C_ORYSJ Protein argonaute 1C OS=Oryza sativa subsp. japonica GN=AGO1C PE=2 SV=1 343 1004 5.0E-71
sp|O77503|AGO2_RABIT Protein argonaute-2 (Fragment) OS=Oryctolagus cuniculus GN=AGO2 PE=1 SV=2 136 1004 8.0E-71
sp|Q6DJB9|AGO2_XENTR Protein argonaute-2 OS=Xenopus tropicalis GN=ago2 PE=2 SV=1 136 1004 6.0E-70
sp|Q6DCX2|AGO2_XENLA Protein argonaute-2 OS=Xenopus laevis GN=ago2 PE=2 SV=1 136 1004 6.0E-70
sp|P34681|TAG76_CAEEL Putative protein tag-76 OS=Caenorhabditis elegans GN=tag-76 PE=3 SV=2 448 1021 6.0E-70
sp|Q5ZMW0|AGO4_CHICK Protein argonaute-4 OS=Gallus gallus GN=AGO4 PE=2 SV=1 218 1004 2.0E-68
sp|Q8CJG1|AGO1_MOUSE Protein argonaute-1 OS=Mus musculus GN=Ago1 PE=1 SV=2 136 1004 5.0E-68
sp|Q9UL18|AGO1_HUMAN Protein argonaute-1 OS=Homo sapiens GN=AGO1 PE=1 SV=3 136 1004 5.0E-68
sp|Q8CJF8|AGO4_MOUSE Protein argonaute-4 OS=Mus musculus GN=Ago4 PE=2 SV=2 136 1004 8.0E-68
sp|Q9HCK5|AGO4_HUMAN Protein argonaute-4 OS=Homo sapiens GN=AGO4 PE=1 SV=2 136 1004 1.0E-67
sp|O74957|AGO1_SCHPO Protein argonaute OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ago1 PE=1 SV=1 341 1002 3.0E-67
sp|Q8CJF9|AGO3_MOUSE Protein argonaute-3 OS=Mus musculus GN=Ago3 PE=2 SV=2 344 1004 3.0E-67
sp|Q4KLV6|AGO4_XENLA Protein argonaute-4 OS=Xenopus laevis GN=ago4 PE=2 SV=1 132 1004 4.0E-67
sp|Q9H9G7|AGO3_HUMAN Protein argonaute-3 OS=Homo sapiens GN=AGO3 PE=1 SV=2 344 1004 1.0E-66
sp|Q10F39|AGO11_ORYSJ Protein argonaute 11 OS=Oryza sativa subsp. japonica GN=AGO11 PE=2 SV=2 470 1007 3.0E-66
sp|Q5ZLG4|AGO3_CHICK Protein argonaute-3 OS=Gallus gallus GN=AGO3 PE=2 SV=1 344 1004 3.0E-66
sp|A3KPK0|AGO3_DANRE Protein argonaute-3 OS=Danio rerio GN=ago3 PE=3 SV=1 344 1004 4.0E-66
sp|Q6T5B7|AGO3_BOVIN Protein argonaute-3 OS=Bos taurus GN=AGO3 PE=2 SV=2 344 1004 4.0E-63
sp|Q6Z4F1|AGO14_ORYSJ Protein argonaute 14 OS=Oryza sativa subsp. japonica GN=AGO14 PE=2 SV=1 136 1004 9.0E-62
sp|Q75HC2|AGO7_ORYSJ Protein argonaute 7 OS=Oryza sativa subsp. japonica GN=AGO7 PE=2 SV=2 343 1004 5.0E-61
sp|Q9SHF3|AGO2_ARATH Protein argonaute 2 OS=Arabidopsis thaliana GN=AGO2 PE=1 SV=1 442 1004 6.0E-60
sp|Q852N2|AGO13_ORYSJ Protein argonaute 13 OS=Oryza sativa subsp. japonica GN=AGO13 PE=2 SV=1 343 1003 1.0E-59
sp|Q9ZVD5|AGO4_ARATH Protein argonaute 4 OS=Arabidopsis thaliana GN=AGO4 PE=1 SV=2 339 996 2.0E-59
sp|Q9C793|AGO7_ARATH Protein argonaute 7 OS=Arabidopsis thaliana GN=AGO7 PE=2 SV=1 117 1004 1.0E-58
sp|Q9VUQ5|AGO2_DROME Protein argonaute-2 OS=Drosophila melanogaster GN=AGO2 PE=1 SV=3 217 1004 2.0E-58
sp|Q0JF58|AGO4B_ORYSJ Protein argonaute 4B OS=Oryza sativa subsp. japonica GN=AGO4B PE=2 SV=1 463 996 2.0E-58
sp|Q9SHF2|AGO3_ARATH Protein argonaute 3 OS=Arabidopsis thaliana GN=AGO3 PE=3 SV=1 456 1004 6.0E-58
sp|Q9SDG8|AGO4A_ORYSJ Protein argonaute 4A OS=Oryza sativa subsp. japonica GN=AGO4A PE=2 SV=1 339 1016 2.0E-56
sp|Q84VQ0|AGO9_ARATH Protein argonaute 9 OS=Arabidopsis thaliana GN=AGO9 PE=1 SV=2 342 996 4.0E-54
sp|Q5NBN9|AGO15_ORYSJ Protein argonaute 15 OS=Oryza sativa subsp. japonica GN=AGO15 PE=2 SV=2 463 996 5.0E-54
sp|Q6YSJ5|AGO16_ORYSJ Protein argonaute 16 OS=Oryza sativa subsp. japonica GN=AGO16 PE=2 SV=2 335 996 1.0E-53
sp|O48771|AGO6_ARATH Protein argonaute 6 OS=Arabidopsis thaliana GN=AGO6 PE=2 SV=2 472 996 5.0E-51
sp|Q7XTS4|AGO2_ORYSJ Protein argonaute 2 OS=Oryza sativa subsp. japonica GN=AGO2 PE=2 SV=2 319 1004 9.0E-51
sp|Q7XTS3|AGO3_ORYSJ Protein argonaute 3 OS=Oryza sativa subsp. japonica GN=AGO3 PE=2 SV=2 459 1004 2.0E-48
sp|Q6H6C3|AGO17_ORYSJ Protein argonaute 17 OS=Oryza sativa subsp. japonica GN=AGO17 PE=2 SV=1 334 1004 2.0E-47
sp|Q3E984|AGO8_ARATH Protein argonaute 8 OS=Arabidopsis thaliana GN=AGO8 PE=3 SV=1 468 996 8.0E-43
sp|Q9JMB7|PIWL1_MOUSE Piwi-like protein 1 OS=Mus musculus GN=Piwil1 PE=1 SV=1 283 994 2.0E-26
sp|O61931|ERGO1_CAEEL Piwi-like protein ergo-1 OS=Caenorhabditis elegans GN=ergo-1 PE=1 SV=2 705 1026 3.0E-26
sp|Q96J94|PIWL1_HUMAN Piwi-like protein 1 OS=Homo sapiens GN=PIWIL1 PE=1 SV=1 283 994 3.0E-26
sp|A6N7Y9|PIWL1_CHICK Piwi-like protein 1 OS=Gallus gallus GN=PIWIL1 PE=2 SV=1 283 994 9.0E-26
sp|Q21770|WAGO1_CAEEL Argonaute protein wago-1 OS=Caenorhabditis elegans GN=wago-1 PE=1 SV=1 473 1002 1.0E-25
sp|Q7Z3Z3|PIWL3_HUMAN Piwi-like protein 3 OS=Homo sapiens GN=PIWIL3 PE=2 SV=2 454 994 8.0E-25
sp|Q8CGT6|PIWL4_MOUSE Piwi-like protein 4 OS=Mus musculus GN=Piwil4 PE=1 SV=3 283 994 8.0E-24
sp|Q8CDG1|PIWL2_MOUSE Piwi-like protein 2 OS=Mus musculus GN=Piwil2 PE=1 SV=2 558 994 1.0E-23
sp|A2CEI6|PIWL2_DANRE Piwi-like protein 2 OS=Danio rerio GN=piwil2 PE=1 SV=2 455 994 1.0E-23
sp|A8KBF3|PIWL2_XENTR Piwi-like protein 2 OS=Xenopus tropicalis GN=piwil2 PE=1 SV=1 455 994 1.0E-23
sp|Q8TC59|PIWL2_HUMAN Piwi-like protein 2 OS=Homo sapiens GN=PIWIL2 PE=1 SV=1 558 994 6.0E-23
sp|Q4G033|PIWL4_RAT Piwi-like protein 4 OS=Rattus norvegicus GN=Piwil4 PE=2 SV=2 689 994 8.0E-23
sp|A6P7L8|PIWL2_ONCMY Piwi-like protein 2 OS=Oncorhynchus mykiss GN=piwil2 PE=2 SV=1 558 994 2.0E-22
sp|Q8UVX0|PIWL1_DANRE Piwi-like protein 1 OS=Danio rerio GN=piwil1 PE=1 SV=1 740 994 9.0E-22
sp|Q09249|YQ53_CAEEL Uncharacterized protein C16C10.3 OS=Caenorhabditis elegans GN=C16C10.3 PE=3 SV=1 456 1002 2.0E-21
sp|Q7PLK0|AGO3_DROME Protein argonaute-3 OS=Drosophila melanogaster GN=AGO3 PE=1 SV=3 740 994 2.0E-21
sp|Q21691|NRDE3_CAEEL Nuclear RNAi defective-3 protein OS=Caenorhabditis elegans GN=nrde-3 PE=1 SV=1 411 991 3.0E-19
sp|Q2Q5Y9|PIWI1_SCHMD Piwi-like protein 1 OS=Schmidtea mediterranea GN=wi-1 PE=2 SV=1 762 1005 3.0E-19
sp|Q9VKM1|PIWI_DROME Protein piwi OS=Drosophila melanogaster GN=piwi PE=1 SV=1 389 988 7.0E-19
sp|Q7Z3Z4|PIWL4_HUMAN Piwi-like protein 4 OS=Homo sapiens GN=PIWIL4 PE=2 SV=2 689 994 3.0E-18
sp|Q2PC95|PIWIL_DUGJA Piwi-like protein OS=Dugesia japonica GN=iwi PE=2 SV=1 767 1005 2.0E-17
sp|Q2Q5Y8|PIWI2_SCHMD Piwi-like protein 2 OS=Schmidtea mediterranea GN=wi-2 PE=2 SV=1 767 1005 1.0E-14
sp|O76922|AUB_DROME Protein aubergine OS=Drosophila melanogaster GN=aub PE=1 SV=1 389 994 2.0E-13
sp|Q86QW7|AGO_GIAIN Protein argonaute OS=Giardia intestinalis GN=Ago PE=1 SV=2 767 987 8.0E-10
sp|A8BCK6|AGO_GIAIC Protein argonaute OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) GN=Ago PE=3 SV=1 767 987 1.0E-09
sp|C6LTG5|AGO_GIAIB Protein argonaute OS=Giardia intestinalis (strain ATCC 50581 / GS clone H7) GN=Ago PE=3 SV=1 767 987 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003676 nucleic acid binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup737
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4073
Ophiocordyceps australis map64 (Brazil) OphauB2|439
Ophiocordyceps camponoti-floridani Ophcf2|01255
Ophiocordyceps camponoti-rufipedis Ophun1|2293 (this protein)
Ophiocordyceps kimflemingae Ophio5|8502
Ophiocordyceps subramaniannii Hirsu2|1954
Ophiocordyceps subramaniannii Hirsu2|978

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2293
MAERGGRGGGRGRGGGDRGGRGGSDRGRGGYDRGRGGYDRGRGGGGGGYRGDRGGGRGGGDRGGRGGGFRGGRPR
DPTLDMVFCPEGSVPTPDPAVRQLEDRVVRELASAAGLTTQMSQASISGTALQAKSTDLFPYRPAYGTNGQAVVV
RANYSAVKAKPIMWFKYTLTFMQVGIETADGPAPDSKSGAREVKGQKLYLAAKELLTVLSAANPSLVLATEFKSQ
LVSNQKLKLEDGEPVRLKLPLGPGSDRVDLIDAKIHGPAEVPLEDLLRFIATMNDGPSDELYPKYPEAVDALNVM
FGYGPRCKLETISAVGNSRYFPFGPDQAIVKLDQDFRPLLAARGFFQSVRLGTGRLLLNVNTTHGVFKDSGRVDK
LFEAFGIQPVQSSDHRGKRQIKDFAKSWPKSRVKVDMFLSNGQKVRKSKTIHGLVSQSELSRPSLSNKLKFTNGF
EYPGPKDVQFPLNDASGKQTYISVADHFKKKYSMNLKNLPLLNLGTAEKPTLYPAEMVEITPGQMVKAKLTMRET
TAMLDEACRTPYSNALSISGDARKTLGLDDSGLAKFGLSVDKNLLTIDARILKVPMVTYLNKQQRAEVVFTKNGS
WNMKNVQVAKPGAMIERWTFLNILKRNDSPVIGKDTMVDFAKFLISSGIRIKPEPVLDRDGRMTTTWERAMANEG
AIEGFLKWAATNKVQYVFFVITEKDTRGLYPKIKSLADCVYGIHTSICLSKHLMKSGNFSYYANVGLKVNLKMGG
INHRLKEELSLLKEGKTMVVGYDVTHPTNMPSGSSKDAPSLVGLVASVDKDCGQWPAYSWEQTSKQEMLSDRLVD
AFKSRLDLWAKHNKNHLPDNIVIYRDGVSEGQYAQVLRDELPFIHEACRAKYSATQKPKLSIIVSVKRHQTRFFP
CSKESMSDSGNVRNGTVVDRGVTQARYWDFYLAAHHALKGTARPAHYTVLLDEVFRSKYKAQAANELQQMTHELC
YLYGRATKAVSICPPAYYADIVCERARVHRPEIFDVSDTESVSTVSAGVASRQRQMAAGPRLLILAGAPAASAVD
EASCTVDRFDAAFRLIGVDAADGGDDEGSQASAAAWRVLSGIRRPFPLAMTAFVPGEESEGVSFLRWDGDRMEDG
GEAWTRFCDESLALSSSSDSVVYDDTSLLDGEDSLLSVVSTATIPACPPLTTLSRIPSARHIISTQPSTQTVNMV
AAMVSISAARTVKTRWGAKELVEVIVGDDTRASGFTVTFWAPASTAVA*
Coding >Ophun1|2293
ATGGCTGAACGTGGTGGTCGCGGTGGTGGCCGAGGCCGCGGAGGCGGAGACCGTGGCGGCCGCGGCGGTTCTGAT
CGGGGCCGCGGCGGCTATGATCGCGGTCGTGGTGGTTATGATCGTGGTCGTGGCGGCGGCGGCGGCGGCTATCGC
GGCGATCGAGGAGGAGGCCGTGGCGGCGGAGACCGCGGCGGTCGTGGAGGCGGCTTCCGGGGCGGCCGTCCTCGC
GATCCCACTCTTGACATGGTATTTTGCCCTGAAGGATCTGTTCCCACTCCAGACCCGGCCGTGAGGCAGCTTGAA
GACCGCGTTGTCCGCGAGCTCGCCTCCGCAGCCGGCTTGACTACTCAAATGAGCCAGGCCAGCATCAGCGGAACG
GCACTTCAGGCCAAGTCGACCGACCTCTTCCCGTATCGTCCCGCCTACGGCACCAATGGTCAAGCTGTGGTCGTC
AGGGCGAACTACTCCGCCGTCAAGGCGAAGCCCATCATGTGGTTCAAGTACACCTTGACCTTCATGCAGGTTGGC
ATTGAGACGGCCGATGGCCCGGCGCCAGACAGCAAGTCCGGCGCCAGGGAGGTCAAGGGTCAAAAGCTGTATCTC
GCGGCGAAAGAACTATTGACGGTTCTGAGTGCAGCGAATCCGTCTCTTGTCCTTGCAACCGAATTCAAGAGTCAG
CTGGTGTCCAATCAGAAACTCAAGCTGGAAGACGGTGAGCCGGTTCGGCTCAAGTTGCCCTTGGGTCCGGGCTCG
GACAGGGTAGACCTGATCGACGCCAAGATTCACGGCCCGGCCGAGGTGCCACTGGAGGACCTTCTACGCTTCATC
GCCACCATGAACGATGGCCCCAGCGACGAGCTCTACCCCAAGTATCCGGAGGCCGTTGACGCTCTCAACGTCATG
TTCGGCTACGGCCCGCGCTGCAAGCTGGAGACCATCTCTGCCGTGGGGAACTCTCGTTACTTTCCTTTCGGTCCC
GATCAGGCCATTGTCAAGCTCGATCAGGACTTCCGTCCTCTCCTCGCCGCCCGCGGTTTCTTCCAGTCGGTTCGC
CTCGGCACTGGCCGGCTGCTACTCAACGTCAATACTACCCACGGGGTGTTCAAGGATTCGGGCCGAGTGGATAAG
CTCTTTGAGGCGTTCGGGATTCAGCCAGTCCAGTCTTCCGACCACCGCGGCAAGAGACAGATCAAGGACTTCGCC
AAGTCCTGGCCGAAGAGTCGTGTCAAGGTCGATATGTTTTTGAGCAACGGCCAGAAAGTTCGCAAGTCTAAAACA
ATCCACGGCCTTGTCTCGCAGTCGGAGTTGTCGCGACCATCGTTGAGCAACAAGCTCAAGTTCACCAACGGGTTC
GAATATCCCGGACCGAAGGACGTACAATTCCCGCTAAACGACGCTTCGGGGAAACAAACGTACATCTCTGTTGCT
GACCACTTCAAAAAGAAGTACTCGATGAATCTGAAGAATCTTCCGCTTCTGAACTTGGGAACTGCAGAAAAGCCG
ACGCTCTATCCCGCGGAAATGGTGGAGATCACGCCAGGTCAGATGGTGAAGGCCAAGTTGACGATGAGGGAGACC
ACGGCGATGCTTGATGAGGCGTGCCGCACGCCTTACTCCAACGCCTTGTCAATCAGTGGCGATGCCCGCAAGACG
CTCGGTCTCGATGACAGCGGGCTTGCCAAATTCGGCCTCAGCGTCGACAAGAATCTGCTGACGATTGATGCCCGC
ATCCTCAAAGTGCCGATGGTCACGTATCTCAATAAGCAGCAGCGCGCCGAGGTTGTGTTTACTAAAAACGGAAGC
TGGAATATGAAGAACGTTCAGGTGGCCAAGCCGGGAGCCATGATCGAGCGCTGGACCTTTCTTAACATCTTGAAG
CGAAACGACAGCCCAGTGATCGGGAAAGACACCATGGTCGATTTTGCCAAATTCCTCATCAGCTCTGGCATCCGC
ATCAAGCCAGAGCCTGTCCTCGACAGGGATGGGAGAATGACGACGACATGGGAAAGGGCCATGGCAAACGAGGGC
GCCATCGAAGGTTTCCTCAAGTGGGCTGCAACCAACAAGGTGCAGTACGTTTTCTTCGTGATCACGGAGAAGGAC
ACGCGAGGTCTTTATCCCAAGATCAAAAGCCTTGCCGACTGCGTCTACGGCATCCACACGAGCATCTGTCTTTCG
AAGCATCTGATGAAGTCCGGCAACTTCTCATACTACGCCAATGTCGGGCTCAAGGTCAACTTGAAGATGGGAGGC
ATCAATCACCGCCTCAAGGAAGAACTGAGCTTGCTGAAAGAGGGCAAGACCATGGTGGTTGGATACGACGTGACG
CACCCGACCAACATGCCCTCGGGCTCGAGCAAGGACGCGCCCAGTCTGGTGGGCCTGGTGGCAAGCGTGGACAAG
GACTGCGGCCAATGGCCGGCATATTCGTGGGAGCAGACGTCGAAGCAGGAGATGCTCAGCGATCGCCTGGTGGAC
GCCTTCAAGTCGCGGCTGGATCTCTGGGCGAAGCACAACAAAAACCACCTTCCGGACAACATTGTCATCTACCGC
GACGGCGTCTCCGAGGGTCAGTACGCGCAGGTGCTGCGCGACGAGCTGCCGTTCATCCACGAGGCGTGCCGTGCC
AAGTACTCAGCGACGCAGAAGCCGAAGCTGAGCATCATTGTCTCGGTGAAGCGACATCAGACACGCTTCTTCCCG
TGCAGCAAGGAGTCCATGTCGGACTCGGGGAACGTGCGCAACGGGACGGTGGTGGACCGAGGAGTGACGCAGGCG
CGTTACTGGGACTTTTACCTGGCAGCGCATCACGCGCTCAAGGGCACGGCGCGTCCGGCTCATTACACGGTTCTT
CTCGACGAGGTGTTCCGGTCCAAGTACAAGGCGCAGGCGGCCAACGAGCTGCAGCAGATGACACACGAGTTGTGC
TATCTGTACGGGCGAGCCACCAAGGCCGTGAGCATCTGTCCGCCGGCTTACTATGCGGACATTGTCTGCGAGCGG
GCCCGCGTACACCGGCCCGAGATCTTCGACGTGAGCGACACGGAGAGCGTCTCGACGGTCAGCGCCGGCGTGGCG
AGTCGCCAGCGTCAGATGGCGGCTGGCCCGCGGCTGTTGATCTTGGCGGGCGCACCGGCGGCGTCTGCGGTGGAC
GAAGCATCGTGCACGGTGGACCGTTTCGACGCGGCTTTTCGACTGATCGGGGTGGACGCCGCCGATGGAGGAGAC
GATGAGGGCTCTCAGGCATCGGCCGCGGCGTGGAGGGTCCTGTCCGGGATACGTCGGCCGTTTCCGCTGGCCATG
ACGGCTTTTGTTCCGGGCGAGGAGTCGGAGGGCGTGTCGTTTCTTCGCTGGGACGGGGACAGGATGGAGGATGGG
GGGGAGGCGTGGACGCGGTTCTGCGATGAGTCGCTTGCTCTGTCTTCGTCTTCGGACTCGGTGGTCTACGACGAT
ACATCTCTTCTCGACGGGGAGGACAGCCTCTTGTCTGTCGTGTCTACGGCCACCATCCCAGCGTGTCCGCCTCTG
ACGACGCTGTCAAGGATACCGTCAGCGCGGCACATCATCTCGACGCAGCCGTCGACGCAGACGGTGAACATGGTG
GCCGCCATGGTGAGCATCTCAGCGGCGCGGACGGTGAAGACGCGATGGGGCGCCAAGGAGCTGGTTGAGGTGATT
GTCGGCGACGACACGCGCGCGTCGGGATTCACCGTCACCTTCTGGGCGCCTGCTTCGACGGCGGTCGCTTAG
Transcript >Ophun1|2293
ATGGCTGAACGTGGTGGTCGCGGTGGTGGCCGAGGCCGCGGAGGCGGAGACCGTGGCGGCCGCGGCGGTTCTGAT
CGGGGCCGCGGCGGCTATGATCGCGGTCGTGGTGGTTATGATCGTGGTCGTGGCGGCGGCGGCGGCGGCTATCGC
GGCGATCGAGGAGGAGGCCGTGGCGGCGGAGACCGCGGCGGTCGTGGAGGCGGCTTCCGGGGCGGCCGTCCTCGC
GATCCCACTCTTGACATGGTATTTTGCCCTGAAGGATCTGTTCCCACTCCAGACCCGGCCGTGAGGCAGCTTGAA
GACCGCGTTGTCCGCGAGCTCGCCTCCGCAGCCGGCTTGACTACTCAAATGAGCCAGGCCAGCATCAGCGGAACG
GCACTTCAGGCCAAGTCGACCGACCTCTTCCCGTATCGTCCCGCCTACGGCACCAATGGTCAAGCTGTGGTCGTC
AGGGCGAACTACTCCGCCGTCAAGGCGAAGCCCATCATGTGGTTCAAGTACACCTTGACCTTCATGCAGGTTGGC
ATTGAGACGGCCGATGGCCCGGCGCCAGACAGCAAGTCCGGCGCCAGGGAGGTCAAGGGTCAAAAGCTGTATCTC
GCGGCGAAAGAACTATTGACGGTTCTGAGTGCAGCGAATCCGTCTCTTGTCCTTGCAACCGAATTCAAGAGTCAG
CTGGTGTCCAATCAGAAACTCAAGCTGGAAGACGGTGAGCCGGTTCGGCTCAAGTTGCCCTTGGGTCCGGGCTCG
GACAGGGTAGACCTGATCGACGCCAAGATTCACGGCCCGGCCGAGGTGCCACTGGAGGACCTTCTACGCTTCATC
GCCACCATGAACGATGGCCCCAGCGACGAGCTCTACCCCAAGTATCCGGAGGCCGTTGACGCTCTCAACGTCATG
TTCGGCTACGGCCCGCGCTGCAAGCTGGAGACCATCTCTGCCGTGGGGAACTCTCGTTACTTTCCTTTCGGTCCC
GATCAGGCCATTGTCAAGCTCGATCAGGACTTCCGTCCTCTCCTCGCCGCCCGCGGTTTCTTCCAGTCGGTTCGC
CTCGGCACTGGCCGGCTGCTACTCAACGTCAATACTACCCACGGGGTGTTCAAGGATTCGGGCCGAGTGGATAAG
CTCTTTGAGGCGTTCGGGATTCAGCCAGTCCAGTCTTCCGACCACCGCGGCAAGAGACAGATCAAGGACTTCGCC
AAGTCCTGGCCGAAGAGTCGTGTCAAGGTCGATATGTTTTTGAGCAACGGCCAGAAAGTTCGCAAGTCTAAAACA
ATCCACGGCCTTGTCTCGCAGTCGGAGTTGTCGCGACCATCGTTGAGCAACAAGCTCAAGTTCACCAACGGGTTC
GAATATCCCGGACCGAAGGACGTACAATTCCCGCTAAACGACGCTTCGGGGAAACAAACGTACATCTCTGTTGCT
GACCACTTCAAAAAGAAGTACTCGATGAATCTGAAGAATCTTCCGCTTCTGAACTTGGGAACTGCAGAAAAGCCG
ACGCTCTATCCCGCGGAAATGGTGGAGATCACGCCAGGTCAGATGGTGAAGGCCAAGTTGACGATGAGGGAGACC
ACGGCGATGCTTGATGAGGCGTGCCGCACGCCTTACTCCAACGCCTTGTCAATCAGTGGCGATGCCCGCAAGACG
CTCGGTCTCGATGACAGCGGGCTTGCCAAATTCGGCCTCAGCGTCGACAAGAATCTGCTGACGATTGATGCCCGC
ATCCTCAAAGTGCCGATGGTCACGTATCTCAATAAGCAGCAGCGCGCCGAGGTTGTGTTTACTAAAAACGGAAGC
TGGAATATGAAGAACGTTCAGGTGGCCAAGCCGGGAGCCATGATCGAGCGCTGGACCTTTCTTAACATCTTGAAG
CGAAACGACAGCCCAGTGATCGGGAAAGACACCATGGTCGATTTTGCCAAATTCCTCATCAGCTCTGGCATCCGC
ATCAAGCCAGAGCCTGTCCTCGACAGGGATGGGAGAATGACGACGACATGGGAAAGGGCCATGGCAAACGAGGGC
GCCATCGAAGGTTTCCTCAAGTGGGCTGCAACCAACAAGGTGCAGTACGTTTTCTTCGTGATCACGGAGAAGGAC
ACGCGAGGTCTTTATCCCAAGATCAAAAGCCTTGCCGACTGCGTCTACGGCATCCACACGAGCATCTGTCTTTCG
AAGCATCTGATGAAGTCCGGCAACTTCTCATACTACGCCAATGTCGGGCTCAAGGTCAACTTGAAGATGGGAGGC
ATCAATCACCGCCTCAAGGAAGAACTGAGCTTGCTGAAAGAGGGCAAGACCATGGTGGTTGGATACGACGTGACG
CACCCGACCAACATGCCCTCGGGCTCGAGCAAGGACGCGCCCAGTCTGGTGGGCCTGGTGGCAAGCGTGGACAAG
GACTGCGGCCAATGGCCGGCATATTCGTGGGAGCAGACGTCGAAGCAGGAGATGCTCAGCGATCGCCTGGTGGAC
GCCTTCAAGTCGCGGCTGGATCTCTGGGCGAAGCACAACAAAAACCACCTTCCGGACAACATTGTCATCTACCGC
GACGGCGTCTCCGAGGGTCAGTACGCGCAGGTGCTGCGCGACGAGCTGCCGTTCATCCACGAGGCGTGCCGTGCC
AAGTACTCAGCGACGCAGAAGCCGAAGCTGAGCATCATTGTCTCGGTGAAGCGACATCAGACACGCTTCTTCCCG
TGCAGCAAGGAGTCCATGTCGGACTCGGGGAACGTGCGCAACGGGACGGTGGTGGACCGAGGAGTGACGCAGGCG
CGTTACTGGGACTTTTACCTGGCAGCGCATCACGCGCTCAAGGGCACGGCGCGTCCGGCTCATTACACGGTTCTT
CTCGACGAGGTGTTCCGGTCCAAGTACAAGGCGCAGGCGGCCAACGAGCTGCAGCAGATGACACACGAGTTGTGC
TATCTGTACGGGCGAGCCACCAAGGCCGTGAGCATCTGTCCGCCGGCTTACTATGCGGACATTGTCTGCGAGCGG
GCCCGCGTACACCGGCCCGAGATCTTCGACGTGAGCGACACGGAGAGCGTCTCGACGGTCAGCGCCGGCGTGGCG
AGTCGCCAGCGTCAGATGGCGGCTGGCCCGCGGCTGTTGATCTTGGCGGGCGCACCGGCGGCGTCTGCGGTGGAC
GAAGCATCGTGCACGGTGGACCGTTTCGACGCGGCTTTTCGACTGATCGGGGTGGACGCCGCCGATGGAGGAGAC
GATGAGGGCTCTCAGGCATCGGCCGCGGCGTGGAGGGTCCTGTCCGGGATACGTCGGCCGTTTCCGCTGGCCATG
ACGGCTTTTGTTCCGGGCGAGGAGTCGGAGGGCGTGTCGTTTCTTCGCTGGGACGGGGACAGGATGGAGGATGGG
GGGGAGGCGTGGACGCGGTTCTGCGATGAGTCGCTTGCTCTGTCTTCGTCTTCGGACTCGGTGGTCTACGACGAT
ACATCTCTTCTCGACGGGGAGGACAGCCTCTTGTCTGTCGTGTCTACGGCCACCATCCCAGCGTGTCCGCCTCTG
ACGACGCTGTCAAGGATACCGTCAGCGCGGCACATCATCTCGACGCAGCCGTCGACGCAGACGGTGAACATGGTG
GCCGCCATGGTGAGCATCTCAGCGGCGCGGACGGTGAAGACGCGATGGGGCGCCAAGGAGCTGGTTGAGGTGATT
GTCGGCGACGACACGCGCGCGTCGGGATTCACCGTCACCTTCTGGGCGCCTGCTTCGACGGCGGTCGCTTAG
Gene >Ophun1|2293
ATGGCTGAACGTGGTGGTCGCGGTGGTGGCCGAGGCCGCGGAGGCGGAGACCGTGGCGGCCGCGGCGGTTCTGAT
CGGGGCCGCGGCGGCTATGATCGCGGTCGTGGTGGTTATGATCGTGGTCGTGGCGGCGGCGGCGGCGGCTATCGC
GGCGATCGAGGAGGAGGCCGTGGCGGCGGAGACCGCGGCGGTCGTGGAGGCGGCTTCCGGGGCGGCCGTCCTCGC
GATCCCACTCTTGACATGGTATTTTGGTAATGCTTCCATCCCCTCGTTAACCCGACTCTGGCCGCTGACGAGACG
TGGTGGTAGCCCTGAAGGATCTGTTCCCACTCCAGACCCGGCCGTGAGGCAGCTTGAAGACCGCGTTGTCCGCGA
GCTCGCCTCCGCAGCCGGCTTGACTACTCAAATGAGCCAGGCCAGCATCAGCGGAACGGCACTTCAGGCCAAGTC
GACCGACCTCTTCCCGTATCGTCCCGCCTACGGCACCAATGGTCAAGCTGTGGTCGTCAGGGCGAACTACTCCGC
CGTCAAGGCGAAGCCCATCATGTGGTTCAAGTACACCTTGACCTTCATGCAGGTTGGCATTGAGACGGCCGATGG
CCCGGCGCCAGACAGCAAGTCCGGCGCCAGGGAGGTCAAGGGTCAAAAGCTGTATCTCGCGGCGAAAGAACTATT
GACGGTTCTGAGTGCAGCGAATCCGTCTCTTGTCCTTGCAACCGAATTCAAGAGTCAGCTGGTGTCCAATCAGAA
ACTCAAGCTGGAAGACGGTGAGCCGGTTCGGCTCAAGTTGCCCTTGGGTCCGGGCTCGGACAGGGTAGACCTGAT
CGACGCCAAGATTCACGGCCCGGCCGAGGTGCCACTGGAGGACCTTCTACGCTTCATCGCCACCATGAACGATGG
CCCCAGCGACGAGCTCTACCCCAAGTATCCGGAGGCCGTTGACGCTCTCAACGTCATGTTCGGCTACGGCCCGCG
CTGCAAGCTGGAGACCATCTCTGCCGTGGGGAACTCTCGTTACTTTCCTTTCGGTCCCGATCAGGCCATTGTCAA
GCTCGATCAGGACTTCCGTCCTCTCCTCGCCGCCCGCGGTTTCTTCCAGTCGGTTCGCCTCGGCACTGGCCGGCT
GCTACTCAACGTCAATACTACCCACGGGGTGTTCAAGGATTCGGGCCGAGTGGATAAGCTCTTTGAGGCGTTCGG
GATTCAGCCAGTCCAGTCTTCCGACCACCGCGGCAAGAGACAGATCAAGGACTTCGCCAAGTCCTGGCCGAAGAG
TCGTGTCAAGGTCGATATGTTTTTGAGCAACGGCCAGAAAGTTCGCAAGTCTAAAACAATCCACGGCCTTGTCTC
GCAGTCGGAGTTGTCGCGACCATCGTTGAGCAACAAGCTCAAGTTCACCAACGGGTTCGAATATCCCGGACCGAA
GGACGTACAATTCCCGCTAAACGACGCTTCGGGGAAACAAACGTACATCTCTGTTGCTGACCACTTCAAAAAGAG
TGAGTTTACCAATCTCGACTGACGGAGGTAATGAGATGCTAACGGCCAACTCCCCGTGCAGAGTACTCGATGAAT
CTGAAGAATCTTCCGCTTCTGAACTTGGGAACTGCAGAAAAGCCGACGCTCTATCCCGCGGAAATGGTGGAGATC
ACGCCAGGTCAGATGGTGAAGGCCAAGTTGACGATGAGGGAGACCACGGCGATGCTTGATGAGGCGTGCCGCACG
CCTTACTCCAACGCCTTGTCAATCAGTGGCGATGCCCGCAAGACGCTCGGTCTCGATGACAGCGGGCTTGCCAAA
TTCGGCCTCAGCGTCGACAAGAATCTGCTGACGATTGATGCCCGCATCCTCAAAGTGCCGATGGTCACGTATCTC
AATAAGCAGCAGCGCGCCGAGGTTGTGTTTACTAAAAACGGAAGCTGGAATATGAAGAACGTTCAGGTGGCCAAG
CCGGGAGCCATGATCGAGCGCTGGACCTTTCTTAACATCTTGAAGCGAAACGACAGCCCAGTGATCGGGAAAGAC
ACCATGGTCGATTTTGCCAAATTCCTCATCAGCTCTGGCATCCGCATCAAGCCAGAGCCTGTCCTCGACAGGGAT
GGGAGAATGACGACGACATGGGAAAGGGCCATGGCAAACGAGGGCGCCATCGAAGGTTTCCTCAAGTGGGCTGCA
ACCAACAAGGTGCAGTACGTTTTCTTCGTGATCACGGAGAAGGACACGCGAGGTCTTTATCCCAAGATCAAAAGC
CTTGCCGACTGCGTCTACGGCATCCACACGAGCATCTGTCTTTCGAAGCATCTGATGAAGTCCGGCAACTTCTCA
TACTACGCCAATGTCGGGCTCAAGGTCAACTTGAAGATGGGAGGCATCAATCACCGCCTCAAGGAAGAACTGAGC
TTGCTGAAAGAGGGCAAGACCATGGTGGTTGGATACGACGTGACGCACCCGACCAACATGCCCTCGGGCTCGAGC
AAGGACGCGCCCAGTCTGGTGGGCCTGGTGGCAAGCGTGGACAAGGACTGCGGCCAATGGCCGGCATATTCGTGG
GAGCAGACGTCGAAGCAGGAGATGCTCAGCGATCGCCTGGTGGACGCCTTCAAGTCGCGGCTGGATCTCTGGGCG
AAGCACAACAAAAACCACCTTCCGGACAACATTGTCATCTACCGCGACGGCGTCTCCGAGGGTCAGTACGCGCAG
GTGCTGCGCGACGAGCTGCCGTTCATCCACGAGGCGTGCCGTGCCAAGTACTCAGCGACGCAGAAGCCGAAGCTG
AGCATCATTGTCTCGGTGAAGCGACATCAGACACGCTTCTTCCCGTGCAGCAAGGAGTCCATGTCGGACTCGGGG
AACGTGCGCAACGGGACGGTGGTGGACCGAGGAGTGACGCAGGCGCGTTACTGGGACTTTTACCTGGCAGCGCAT
CACGCGCTCAAGGGCACGGCGCGTCCGGCTCATTACACGGTTCTTCTCGACGAGGTGTTCCGGTCCAAGTACAAG
GCGCAGGCGGCCAACGAGCTGCAGCAGATGACACACGAGTTGTGCTATCTGTACGGGCGAGCCACCAAGGCCGTG
AGCATCTGTCCGCCGGCTTACTATGCGGACATTGTCTGCGAGCGGGCCCGCGTACACCGGCCCGAGATCTTCGAC
GTGAGCGACACGGAGAGCGTCTCGACGGTCAGCGCCGGCGTGGCGAGTCGCCAGGTGCACGCGGCGCTCAAAGAT
AGCATGTACTACATTTAGGCGGCCGACGATGGGATGGATGGTTTAGGAGGCGGAGAAGTGAAGAGACGAGATTGT
GGGAAAGCGCATGTTTGGTTTTGCATTTGTTATTTCGCAAGGGTCTCCTGACAAGTCGGTGACGATTTGCGCAGC
GACGACAGCGAACCGATGAAGTCTATAGCAGAATGATCATCTCACGTCTCTCTCTCACCTTCATCTTCTCACTCA
CTGCTTCTTCGGATGTAGTTGCTTCGATGACGTAAGCGAGGCTGAGATGACAGACCTCTGGCAGACGGCTTGCAA
GCTGCCGTGACTCGTGAGTCGTGCTACAGCCGCCATGTCGGCAGCCCAGCCCCGTGTCACCAGTTGTTGTGTGCG
GCTCCATACATACCCCAGCGTCAGATGGCGGCTGGCCCGCGGCTGTTGATCTTGGCGGGCGCACCGGCGGCGTCT
GCGGTGGACGAAGCATCGTGCACGGTGGACCGTTTCGACGCGGCTTTTCGACTGATCGGGGTGGACGCCGCCGAT
GGAGGAGACGATGAGGGCTCTCAGGCATCGGCCGCGGCGTGGAGGGTCCTGTCCGGGATACGTCGGCCGTTTCCG
CTGGCCATGACGGCTTTTGTTCCGGGCGAGGAGTCGGAGGGCGTGTCGTTTCTTCGCTGGGACGGGGACAGGATG
GAGGATGGGGGGGAGGCGTGGACGCGGTTCTGCGATGAGTCGCTTGCTCTGTCTTCGTCTTCGGACTCGGTGGTC
TACGACGATACATCTCTTCTCGACGGGGAGGACAGCCTCTTGTCTGTCGTGTCTACGGCCACCATCCCAGCGTGT
CCGCCTCTGACGACGCTGTCAAGGATACCGTCAGCGCGGCACATCATCTCGACGCAGCCGTCGACGCAGACGGTG
AACATGGTGGCCGCCATGGTGAGCATCTCAGCGGCGCGGACGGTGAAGACGCGATGGGGCGCCAAGGAGCTGGTT
GAGGTGATTGTCGGCGACGACACGCGCGCGTCGGGATTCACCGTCACCTTCTGGGCGCCTGCTTCGACGGCGGGT
CTGGCGAGGCAGGATGTCGTGCTGTTGCGGAATGTCGCGTTGGGAGTCTTTCGTGGGCATGTCTTTGGGCAGTCG
CTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail