Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2277
Gene name
LocationContig_21:25032..25928
Strand-
Gene length (bp)896
Transcript length (bp)780
Coding sequence length (bp)780
Protein length (aa) 260

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17903 KH_8 Krr1 KH1 domain 1.1E-05 88 158

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IN63|PNO1_GIBZE Pre-rRNA-processing protein PNO1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PNO1 PE=3 SV=1 1 259 5.0E-141
sp|Q0UWT7|PNO1_PHANO Pre-rRNA-processing protein PNO1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PNO1 PE=3 SV=1 1 259 9.0E-120
sp|Q1DQZ5|PNO1_COCIM Pre-rRNA-processing protein PNO1 OS=Coccidioides immitis (strain RS) GN=PNO1 PE=3 SV=1 1 259 1.0E-119
sp|Q6BJ75|PNO1_DEBHA Pre-rRNA-processing protein PNO1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PNO1 PE=3 SV=1 1 259 2.0E-115
sp|Q5ACM4|PNO1_CANAL Pre-rRNA-processing protein PNO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PNO1 PE=3 SV=1 1 259 1.0E-114
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IN63|PNO1_GIBZE Pre-rRNA-processing protein PNO1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PNO1 PE=3 SV=1 1 259 5.0E-141
sp|Q0UWT7|PNO1_PHANO Pre-rRNA-processing protein PNO1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PNO1 PE=3 SV=1 1 259 9.0E-120
sp|Q1DQZ5|PNO1_COCIM Pre-rRNA-processing protein PNO1 OS=Coccidioides immitis (strain RS) GN=PNO1 PE=3 SV=1 1 259 1.0E-119
sp|Q6BJ75|PNO1_DEBHA Pre-rRNA-processing protein PNO1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PNO1 PE=3 SV=1 1 259 2.0E-115
sp|Q5ACM4|PNO1_CANAL Pre-rRNA-processing protein PNO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PNO1 PE=3 SV=1 1 259 1.0E-114
sp|Q2UMG1|PNO1_ASPOR Pre-rRNA-processing protein pno1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pno1 PE=3 SV=1 1 259 2.0E-113
sp|Q5B0Z5|PNO1_EMENI Pre-rRNA-processing protein pno1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pno1 PE=3 SV=1 1 259 2.0E-112
sp|Q4WNG7|PNO1_ASPFU Pre-rRNA-processing protein pno1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pno1 PE=3 SV=1 1 259 2.0E-109
sp|Q6FMB3|PNO1_CANGA Pre-rRNA-processing protein PNO1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PNO1 PE=3 SV=1 44 259 7.0E-108
sp|Q6CUA5|PNO1_KLULA Pre-rRNA-processing protein PNO1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PNO1 PE=3 SV=1 1 259 2.0E-107
sp|Q753C6|PNO1_ASHGO Pre-rRNA-processing protein PNO1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PNO1 PE=3 SV=3 50 259 5.0E-107
sp|Q99216|PNO1_YEAST Pre-rRNA-processing protein PNO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PNO1 PE=1 SV=1 44 259 2.0E-106
sp|Q6C7G0|PNO1_YARLI Pre-rRNA-processing protein PNO1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PNO1 PE=3 SV=1 3 259 1.0E-104
sp|O14044|PNO1_SCHPO Pre-rRNA-processing protein pno1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rbp28 PE=1 SV=2 37 259 2.0E-93
sp|A7RP64|PNO1_NEMVE RNA-binding protein pno1 OS=Nematostella vectensis GN=pno1 PE=3 SV=1 35 259 1.0E-83
sp|Q6DDB9|PNO1_XENTR RNA-binding protein PNO1 OS=Xenopus tropicalis GN=pno1 PE=2 SV=1 65 259 7.0E-83
sp|Q29IG6|PNO1_DROPS RNA-binding protein pno1 OS=Drosophila pseudoobscura pseudoobscura GN=l(1)G0004 PE=3 SV=1 78 259 2.0E-82
sp|Q8AVH4|PNO1_XENLA RNA-binding protein PNO1 OS=Xenopus laevis GN=pno1 PE=2 SV=1 65 259 3.0E-82
sp|Q6VBQ8|PNO1_RAT RNA-binding protein PNO1 OS=Rattus norvegicus GN=Pno1 PE=2 SV=1 44 259 3.0E-82
sp|Q7YRD0|PNO1_BOVIN RNA-binding protein PNO1 OS=Bos taurus GN=PNO1 PE=2 SV=1 44 259 8.0E-82
sp|Q9NRX1|PNO1_HUMAN RNA-binding protein PNO1 OS=Homo sapiens GN=PNO1 PE=1 SV=1 44 259 3.0E-81
sp|Q6VEU3|PNO1_DANRE RNA-binding protein PNO1 OS=Danio rerio GN=pno1 PE=2 SV=2 81 259 4.0E-81
sp|Q9VR89|PNO1_DROME RNA-binding protein pno1 OS=Drosophila melanogaster GN=l(1)G0004 PE=2 SV=1 45 259 6.0E-81
sp|Q54K66|PNO1_DICDI RNA-binding protein pno1 OS=Dictyostelium discoideum GN=pno1 PE=3 SV=1 81 259 7.0E-81
sp|Q9CPS7|PNO1_MOUSE RNA-binding protein PNO1 OS=Mus musculus GN=Pno1 PE=1 SV=1 44 259 1.0E-80
sp|Q5F414|PNO1_CHICK RNA-binding protein PNO1 OS=Gallus gallus GN=PNO1 PE=2 SV=1 81 259 3.0E-79
sp|P0CO46|PNO1_CRYNJ Pre-rRNA-processing protein PNO1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PNO1 PE=3 SV=1 68 259 2.0E-78
sp|P0CO47|PNO1_CRYNB Pre-rRNA-processing protein PNO1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PNO1 PE=3 SV=1 68 259 2.0E-78
sp|Q4PMC9|PNO1_IXOSC RNA-binding protein pno1 OS=Ixodes scapularis PE=2 SV=1 53 259 4.0E-78
sp|Q6VBQ6|PNO1_ORYLA RNA-binding protein PNO1 OS=Oryzias latipes GN=pno1 PE=2 SV=1 65 259 9.0E-78
sp|O18216|PNO1_CAEEL RNA-binding protein pno-1 OS=Caenorhabditis elegans GN=pno-1 PE=3 SV=1 19 259 8.0E-70
sp|Q626C1|PNO1_CAEBR RNA-binding protein pno-1 OS=Caenorhabditis briggsae GN=pno-1 PE=3 SV=1 81 259 2.0E-68
sp|Q57885|Y443_METJA KH domain-containing protein MJ0443 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0443 PE=3 SV=1 122 245 6.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4126
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3242
Ophiocordyceps australis map64 (Brazil) OphauB2|5570
Ophiocordyceps camponoti-floridani Ophcf2|00108
Ophiocordyceps camponoti-rufipedis Ophun1|2277 (this protein)
Ophiocordyceps kimflemingae Ophio5|3835
Ophiocordyceps subramaniannii Hirsu2|8360

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2277
MPAPTALKRAEPAKESTVTSERDDEFLLEPRGRHPVQDQIVPPQQEDDAQQGDDADAMAIDEEGRPRFAPAKDMD
SAIRVEMRKIPVPPHRMTPLKQAWPSIYPPLVEHLKLQCRMNIKRKTVELRTSKHTTDSGALQKGEDFVKAFTLG
FDVDDAIALLRLDDLYIETFEIKDVRIMHGDSQARAIGRIAGKDGKTKFAIENVSRTRIVLADAKIHILGGFKNI
HIARESIVSLILGKPPGKVYGNLRTVATRMKERF*
Coding >Ophun1|2277
ATGCCCGCGCCCACGGCTTTGAAGCGGGCAGAACCGGCCAAAGAGAGTACAGTAACGTCAGAGCGAGACGATGAA
TTCCTGCTCGAACCTCGAGGTCGCCATCCCGTTCAAGATCAGATCGTTCCACCTCAACAAGAAGACGATGCTCAA
CAAGGAGACGATGCTGATGCCATGGCCATCGATGAGGAGGGCAGACCACGGTTCGCACCGGCAAAGGACATGGAT
TCTGCCATCAGAGTGGAGATGCGCAAGATACCAGTGCCGCCGCATCGTATGACGCCTCTCAAGCAAGCCTGGCCC
TCCATCTACCCCCCCTTGGTCGAGCACCTCAAGCTCCAGTGTCGGATGAATATAAAGCGCAAGACTGTGGAATTG
AGAACTTCGAAGCACACCACGGACTCTGGGGCACTGCAAAAAGGCGAGGATTTCGTCAAGGCCTTTACCCTGGGA
TTTGACGTCGACGACGCCATCGCCCTCTTGCGACTGGACGATTTATACATCGAGACGTTTGAGATTAAAGATGTC
AGAATTATGCACGGCGACAGCCAGGCACGCGCCATCGGTCGAATCGCTGGAAAGGACGGCAAGACAAAGTTTGCC
ATTGAGAATGTCAGTCGGACGAGAATCGTGCTGGCAGATGCCAAGATCCATATTCTGGGAGGCTTCAAGAATATT
CACATCGCGCGGGAGTCAATCGTCAGCCTGATTCTCGGGAAGCCGCCTGGGAAAGTCTACGGCAACCTAAGGACC
GTTGCCACGCGGATGAAGGAAAGATTTTGA
Transcript >Ophun1|2277
ATGCCCGCGCCCACGGCTTTGAAGCGGGCAGAACCGGCCAAAGAGAGTACAGTAACGTCAGAGCGAGACGATGAA
TTCCTGCTCGAACCTCGAGGTCGCCATCCCGTTCAAGATCAGATCGTTCCACCTCAACAAGAAGACGATGCTCAA
CAAGGAGACGATGCTGATGCCATGGCCATCGATGAGGAGGGCAGACCACGGTTCGCACCGGCAAAGGACATGGAT
TCTGCCATCAGAGTGGAGATGCGCAAGATACCAGTGCCGCCGCATCGTATGACGCCTCTCAAGCAAGCCTGGCCC
TCCATCTACCCCCCCTTGGTCGAGCACCTCAAGCTCCAGTGTCGGATGAATATAAAGCGCAAGACTGTGGAATTG
AGAACTTCGAAGCACACCACGGACTCTGGGGCACTGCAAAAAGGCGAGGATTTCGTCAAGGCCTTTACCCTGGGA
TTTGACGTCGACGACGCCATCGCCCTCTTGCGACTGGACGATTTATACATCGAGACGTTTGAGATTAAAGATGTC
AGAATTATGCACGGCGACAGCCAGGCACGCGCCATCGGTCGAATCGCTGGAAAGGACGGCAAGACAAAGTTTGCC
ATTGAGAATGTCAGTCGGACGAGAATCGTGCTGGCAGATGCCAAGATCCATATTCTGGGAGGCTTCAAGAATATT
CACATCGCGCGGGAGTCAATCGTCAGCCTGATTCTCGGGAAGCCGCCTGGGAAAGTCTACGGCAACCTAAGGACC
GTTGCCACGCGGATGAAGGAAAGATTTTGA
Gene >Ophun1|2277
ATGCCCGCGCCCACGGCTTTGAAGCGGGCAGAACCGGCCAAAGAGAGTACAGTAACGTCAGGTAAATGACCATCC
GTATCCTTGGTCTGGTCGCTTCTGCGAATACATCTCTGACAATAATCAGAGCGAGACGATGAATTCCTGCTCGAA
CCTCGAGGTCGCCATCCCGTTCAAGATCAGATCGTTCCACCTCAACAAGAAGACGATGCTCAACAAGGAGACGAT
GCTGATGCCATGGCCATCGATGAGGAGGGCAGACCACGGTTCGCACCGGCAAAGGACATGGTGCGCCGGCTCTTT
GCACTTTTCCCAACTCCTCAATGACTGACGCAAAGCAGGATTCTGCCATCAGAGTGGAGATGCGCAAGATACCAG
TGCCGCCGCATCGTATGACGCCTCTCAAGCAAGCCTGGCCCTCCATCTACCCCCCCTTGGTCGAGCACCTCAAGC
TCCAGTGTCGGATGAATATAAAGCGCAAGACTGTGGAATTGAGAACTTCGAAGCACACCACGGACTCTGGGGCAC
TGCAAAAAGGCGAGGATTTCGTCAAGGCCTTTACCCTGGGATTTGACGTCGACGACGCCATCGCCCTCTTGCGAC
TGGACGATTTATACATCGAGACGTTTGAGATTAAAGATGTCAGAATTATGCACGGCGACAGCCAGGCACGCGCCA
TCGGTCGAATCGCTGGAAAGGACGGCAAGACAAAGTTTGCCATTGAGAATGTCAGTCGGACGAGAATCGTGCTGG
CAGATGCCAAGATCCATATTCTGGGAGGCTTCAAGAATATTCACATCGCGCGGGAGTCAATCGTCAGCCTGATTC
TCGGGAAGCCGCCTGGGAAAGTCTACGGCAACCTAAGGACCGTTGCCACGCGGATGAAGGAAAGATTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail