Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2275
Gene name
LocationContig_21:18539..22098
Strand-
Gene length (bp)3559
Transcript length (bp)3351
Coding sequence length (bp)3351
Protein length (aa) 1117

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08311 Mad3_BUB1_I Mad3/BUB1 homology region 1 4.0E-42 55 179
PF00069 Pkinase Protein kinase domain 2.1E-09 819 1011
PF08171 Mad3_BUB1_II Mad3/BUB1 homology region 2 2.7E-06 318 390

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94751|BUB1_SCHPO Checkpoint serine/threonine-protein kinase bub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bub1 PE=1 SV=1 690 1099 9.0E-79
sp|P41695|BUB1_YEAST Checkpoint serine/threonine-protein kinase BUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUB1 PE=1 SV=2 679 1108 3.0E-74
sp|F4IVI0|BUB1_ARATH Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Arabidopsis thaliana GN=BUB1 PE=1 SV=1 808 1097 2.0E-46
sp|O08901|BUB1_MOUSE Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Mus musculus GN=Bub1 PE=1 SV=1 691 1051 2.0E-39
sp|O59767|MAD3_SCHPO Mitotic spindle checkpoint component mad3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mad3 PE=1 SV=2 5 307 4.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94751|BUB1_SCHPO Checkpoint serine/threonine-protein kinase bub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bub1 PE=1 SV=1 690 1099 9.0E-79
sp|P41695|BUB1_YEAST Checkpoint serine/threonine-protein kinase BUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUB1 PE=1 SV=2 679 1108 3.0E-74
sp|F4IVI0|BUB1_ARATH Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Arabidopsis thaliana GN=BUB1 PE=1 SV=1 808 1097 2.0E-46
sp|O08901|BUB1_MOUSE Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Mus musculus GN=Bub1 PE=1 SV=1 691 1051 2.0E-39
sp|O59767|MAD3_SCHPO Mitotic spindle checkpoint component mad3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mad3 PE=1 SV=2 5 307 4.0E-39
sp|O43683|BUB1_HUMAN Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Homo sapiens GN=BUB1 PE=1 SV=1 768 1051 1.0E-35
sp|P47074|MAD3_YEAST Spindle assembly checkpoint component MAD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAD3 PE=1 SV=1 4 395 6.0E-30
sp|Q54CV5|BUB1_DICDI Probable inactive serine/threonine-protein kinase bub1 OS=Dictyostelium discoideum GN=bub1 PE=3 SV=1 14 200 9.0E-26
sp|Q21776|BUB1_CAEEL Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Caenorhabditis elegans GN=bub-1 PE=1 SV=1 679 1018 1.0E-25
sp|Q9Z1S0|BUB1B_MOUSE Mitotic checkpoint serine/threonine-protein kinase BUB1 beta OS=Mus musculus GN=Bub1b PE=1 SV=2 14 202 5.0E-23
sp|P41695|BUB1_YEAST Checkpoint serine/threonine-protein kinase BUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUB1 PE=1 SV=2 39 203 3.0E-21
sp|Q54CV5|BUB1_DICDI Probable inactive serine/threonine-protein kinase bub1 OS=Dictyostelium discoideum GN=bub1 PE=3 SV=1 796 1007 1.0E-20
sp|O60566|BUB1B_HUMAN Mitotic checkpoint serine/threonine-protein kinase BUB1 beta OS=Homo sapiens GN=BUB1B PE=1 SV=3 11 202 2.0E-20
sp|O22806|BUBR1_ARATH Mitotic spindle checkpoint protein BUBR1 OS=Arabidopsis thaliana GN=BUBR1 PE=1 SV=2 17 302 1.0E-19
sp|O94751|BUB1_SCHPO Checkpoint serine/threonine-protein kinase bub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bub1 PE=1 SV=1 58 478 6.0E-19
sp|O08901|BUB1_MOUSE Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Mus musculus GN=Bub1 PE=1 SV=1 58 212 3.0E-13
sp|O43683|BUB1_HUMAN Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Homo sapiens GN=BUB1 PE=1 SV=1 67 212 3.0E-12
sp|F4IVI0|BUB1_ARATH Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Arabidopsis thaliana GN=BUB1 PE=1 SV=1 97 202 5.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup198
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3243
Ophiocordyceps australis 1348a (Ghana) OphauG2|3244
Ophiocordyceps australis map64 (Brazil) OphauB2|5568
Ophiocordyceps australis map64 (Brazil) OphauB2|5569
Ophiocordyceps camponoti-floridani Ophcf2|00105
Ophiocordyceps camponoti-floridani Ophcf2|00107
Ophiocordyceps camponoti-rufipedis Ophun1|2275 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2276
Ophiocordyceps kimflemingae Ophio5|7488
Ophiocordyceps kimflemingae Ophio5|868
Ophiocordyceps subramaniannii Hirsu2|8357
Ophiocordyceps subramaniannii Hirsu2|8359

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2275
MPDSEDLISFDVIEGEKENIQSLPGGRSAKKLAELATLDRHSRPSSTKTVNDCIRIEYEAELENLAESDDPLDVF
DRYVRWTLDAYPSAQATPQSQLHTLLERATKAFISSTTYRNDARYLRLWMHYIHLFADAPRETFVFLSRHGIGDS
LALFYEEYAAWLETAGRWAQAAEVYRLGIEREARPLQRLVRKMDEFQGRLAKLPGETIADAPSSPALPTMRPALA
AKLDPFASSSVEAETQQPQATVAGASRSSRPKLAVFSDTGMEPAPASLSRGEGSKGWDNIGSLSDRKKENTMKPT
PWLGETLKAGGSKARTAKMNVFRDASLSKINNFVVVPSRDQVTIHPQTGKKETIFVDLAALYPTPELLGTELSFE
EIMAAKRGWLPRIWDDEDSPDGTRDMVSDSAVRYDENGAEIKAVQGSRPSKKKVMEVNETQIIKAKLDSPSGPKL
RKKSTEPTMTIHTRAATDDIYDIFNAPLHKPRDSPESADEDEYETDGDYTTDAESTGTTRPVDVSQQEDEATTAD
VKSPGEWTGVVALRPALDDEGNARYSNEIPKGAFNGPDVVEKKREDEQLAEYGDDDDNGNDDDDNNDVDDQDMAE
SMPRTRTVFTPLPPEDYNAPTRPYRDPVEAANCRLPFMTPITERTECSLDGETERERQQQLAKTPSRRDEYSSVS
LLQRPQSPVIKDRRCNPVDEAIRRDILNSLSPPLASYHGFHDRREERYERGSEIRKYIKAVGKAAKDKTATSPDA
LVLRFPETRAAFSLKRELGVGAFAPVYLVEKSMPNEAEADDEAGSDLSAASRRSRLEALKMESPPSAWEFHMMRL
VHERLVHERLGSGHRVATSLSHAHELHLYRDEAFLFLPFHAHGTLLDVVNLFRAEPSGVMDELLAMFFAIELLRT
VDALHAKGILHGDLKPDNCLLRVPAEHQPLETQWEADGGGGWAARGVVLIDFGRSIDMMAFSSDVEFIADWKTGP
QDCPEMRESRPWTWQIDYHGLAATIHCLLFGKYMETTRCDQGNVLGSAGRRYRIRESLKRYWQTDLWADLFDMLL
NPLSYVDGEQAASMPLLGATANLRHRMERWLEANCDRGVGLRSLMSKLEAHAKESQTKMPRARSKA*
Coding >Ophun1|2275
ATGCCGGACTCGGAGGATCTCATCAGCTTCGACGTGATCGAGGGGGAAAAGGAGAACATCCAGTCCCTTCCGGGG
GGACGATCAGCCAAGAAGCTCGCCGAGCTCGCGACTCTGGACCGCCACTCGCGACCGTCGTCGACAAAGACGGTC
AACGACTGCATTCGCATAGAATACGAGGCTGAGCTGGAAAACCTGGCCGAGTCGGATGACCCACTAGACGTCTTC
GACCGGTACGTCCGATGGACGCTCGATGCCTATCCTTCAGCGCAGGCGACGCCTCAGTCGCAGCTTCACACGCTG
CTCGAACGGGCGACGAAGGCGTTCATCTCTTCGACGACGTACCGCAATGATGCCCGCTATCTGAGGTTATGGATG
CATTACATTCACCTCTTCGCCGACGCGCCGCGCGAGACGTTCGTCTTTCTCTCGCGTCATGGCATCGGTGACTCG
CTGGCCCTGTTCTACGAGGAGTACGCGGCTTGGCTTGAGACGGCCGGCCGCTGGGCTCAGGCGGCTGAGGTCTAC
AGGCTCGGCATCGAGCGCGAGGCTCGTCCCCTTCAGCGGCTGGTGCGCAAGATGGATGAGTTTCAGGGGAGGCTT
GCGAAGCTGCCCGGAGAGACTATCGCCGATGCTCCCTCTTCTCCTGCTCTTCCAACGATGCGTCCGGCTCTGGCT
GCCAAATTGGATCCGTTTGCTTCGTCGTCGGTTGAGGCCGAGACGCAGCAGCCGCAGGCGACGGTCGCAGGCGCC
TCGCGCTCGTCCAGACCAAAGTTGGCAGTCTTCTCGGATACCGGAATGGAACCGGCCCCTGCTTCATTGTCTAGG
GGCGAAGGGTCCAAGGGATGGGATAACATCGGATCCCTCTCTGATCGCAAGAAGGAGAACACGATGAAGCCTACA
CCGTGGCTGGGAGAGACGCTGAAAGCTGGCGGCAGCAAGGCGAGGACGGCCAAGATGAACGTCTTCAGGGATGCG
TCGCTCTCGAAAATAAACAACTTTGTTGTCGTCCCTTCGAGGGATCAAGTGACGATCCACCCTCAAACGGGCAAG
AAGGAAACCATCTTTGTCGATCTCGCAGCTCTATATCCGACACCAGAGCTTCTCGGAACGGAATTGAGCTTCGAA
GAAATCATGGCAGCAAAGCGAGGATGGCTTCCCCGTATCTGGGATGACGAGGACTCGCCCGATGGAACACGCGAC
ATGGTCAGCGACTCTGCTGTTCGTTACGACGAGAACGGAGCCGAGATCAAGGCAGTCCAAGGATCTCGTCCTAGC
AAGAAGAAGGTGATGGAGGTCAACGAGACACAGATCATCAAGGCCAAGCTCGATTCTCCTTCGGGACCCAAGCTT
CGCAAGAAGAGCACAGAGCCGACAATGACGATTCACACCAGGGCGGCCACGGACGACATATACGACATATTCAAC
GCGCCTCTTCACAAGCCACGGGACAGTCCAGAGAGTGCTGATGAAGACGAGTACGAGACGGACGGCGACTATACG
ACCGACGCCGAGAGTACCGGCACGACGAGGCCTGTCGATGTCAGTCAGCAAGAGGACGAGGCGACGACGGCTGAC
GTCAAGAGCCCCGGAGAGTGGACTGGTGTTGTGGCTCTGCGGCCTGCGCTGGACGACGAGGGCAACGCCCGATAC
TCCAATGAGATACCGAAAGGTGCCTTCAACGGTCCAGATGTGGTCGAGAAGAAGCGTGAGGACGAGCAGCTGGCT
GAGTACGGAGATGACGACGACAATGGTAACGATGACGACGATAATAACGACGTCGACGACCAAGACATGGCCGAG
TCGATGCCGAGGACGCGAACCGTCTTCACTCCCTTACCCCCTGAAGACTACAACGCCCCAACTCGTCCGTATAGG
GATCCGGTCGAGGCGGCGAACTGTCGACTGCCGTTCATGACGCCCATCACGGAACGGACGGAGTGCTCTCTGGAT
GGGGAGACGGAACGCGAGAGACAGCAGCAGCTAGCCAAGACGCCGTCCAGGAGAGACGAGTACTCGTCCGTGAGC
CTCCTCCAGCGTCCTCAGAGTCCCGTCATCAAGGACAGGCGGTGCAATCCGGTCGACGAGGCGATTCGTCGTGAC
ATTCTGAACAGCCTCAGTCCTCCGCTGGCCTCGTATCACGGCTTCCACGATCGCAGAGAGGAGAGGTACGAGCGC
GGCTCTGAAATCCGCAAGTACATCAAGGCCGTGGGCAAGGCCGCCAAAGACAAGACCGCGACCAGCCCTGATGCT
CTCGTGCTTCGCTTCCCGGAGACGAGGGCCGCCTTCAGTCTCAAGCGAGAGCTGGGCGTCGGCGCATTTGCCCCC
GTCTACCTTGTCGAGAAGTCGATGCCGAACGAGGCCGAGGCTGACGATGAGGCCGGCTCCGACTTGAGCGCCGCC
AGTCGCCGCAGCAGGCTCGAGGCCCTCAAGATGGAATCGCCTCCATCTGCATGGGAGTTTCATATGATGCGCCTG
GTTCATGAGCGCCTGGTTCATGAGCGCCTGGGATCCGGACACCGAGTCGCGACGTCTCTTTCACACGCTCACGAG
TTGCACCTGTATCGAGACGAGGCCTTCCTCTTCCTCCCTTTTCACGCGCACGGCACGCTGCTCGACGTCGTCAAT
CTCTTCCGCGCCGAGCCCTCGGGCGTCATGGACGAGCTGCTGGCCATGTTCTTCGCCATCGAGCTACTGCGTACC
GTCGACGCCCTCCACGCAAAGGGCATCTTGCACGGCGACCTCAAGCCCGACAACTGCCTGCTCCGCGTGCCGGCC
GAACACCAGCCGCTGGAGACCCAATGGGAGGCGGACGGCGGCGGCGGCTGGGCGGCCAGGGGCGTCGTCCTCATC
GACTTTGGCCGCAGCATCGACATGATGGCCTTTTCATCCGACGTCGAGTTCATCGCCGACTGGAAGACGGGCCCT
CAGGACTGTCCCGAGATGCGCGAGAGCCGCCCGTGGACGTGGCAGATCGACTACCACGGCCTCGCCGCCACCATC
CACTGCCTGCTCTTCGGCAAGTACATGGAGACGACACGCTGTGATCAGGGCAACGTTTTGGGCAGCGCCGGCCGC
AGGTACAGAATCCGCGAGAGTCTGAAGCGTTACTGGCAGACGGACCTCTGGGCCGACCTCTTCGACATGCTGCTC
AACCCGCTCTCGTATGTAGATGGTGAACAAGCCGCGAGCATGCCGCTGCTCGGGGCCACGGCGAATCTTCGTCAC
CGAATGGAGCGCTGGCTTGAGGCCAATTGCGATAGGGGCGTCGGACTGCGGTCGCTCATGAGCAAGCTCGAGGCT
CATGCGAAGGAGTCGCAGACGAAGATGCCTCGGGCTCGATCGAAAGCATAG
Transcript >Ophun1|2275
ATGCCGGACTCGGAGGATCTCATCAGCTTCGACGTGATCGAGGGGGAAAAGGAGAACATCCAGTCCCTTCCGGGG
GGACGATCAGCCAAGAAGCTCGCCGAGCTCGCGACTCTGGACCGCCACTCGCGACCGTCGTCGACAAAGACGGTC
AACGACTGCATTCGCATAGAATACGAGGCTGAGCTGGAAAACCTGGCCGAGTCGGATGACCCACTAGACGTCTTC
GACCGGTACGTCCGATGGACGCTCGATGCCTATCCTTCAGCGCAGGCGACGCCTCAGTCGCAGCTTCACACGCTG
CTCGAACGGGCGACGAAGGCGTTCATCTCTTCGACGACGTACCGCAATGATGCCCGCTATCTGAGGTTATGGATG
CATTACATTCACCTCTTCGCCGACGCGCCGCGCGAGACGTTCGTCTTTCTCTCGCGTCATGGCATCGGTGACTCG
CTGGCCCTGTTCTACGAGGAGTACGCGGCTTGGCTTGAGACGGCCGGCCGCTGGGCTCAGGCGGCTGAGGTCTAC
AGGCTCGGCATCGAGCGCGAGGCTCGTCCCCTTCAGCGGCTGGTGCGCAAGATGGATGAGTTTCAGGGGAGGCTT
GCGAAGCTGCCCGGAGAGACTATCGCCGATGCTCCCTCTTCTCCTGCTCTTCCAACGATGCGTCCGGCTCTGGCT
GCCAAATTGGATCCGTTTGCTTCGTCGTCGGTTGAGGCCGAGACGCAGCAGCCGCAGGCGACGGTCGCAGGCGCC
TCGCGCTCGTCCAGACCAAAGTTGGCAGTCTTCTCGGATACCGGAATGGAACCGGCCCCTGCTTCATTGTCTAGG
GGCGAAGGGTCCAAGGGATGGGATAACATCGGATCCCTCTCTGATCGCAAGAAGGAGAACACGATGAAGCCTACA
CCGTGGCTGGGAGAGACGCTGAAAGCTGGCGGCAGCAAGGCGAGGACGGCCAAGATGAACGTCTTCAGGGATGCG
TCGCTCTCGAAAATAAACAACTTTGTTGTCGTCCCTTCGAGGGATCAAGTGACGATCCACCCTCAAACGGGCAAG
AAGGAAACCATCTTTGTCGATCTCGCAGCTCTATATCCGACACCAGAGCTTCTCGGAACGGAATTGAGCTTCGAA
GAAATCATGGCAGCAAAGCGAGGATGGCTTCCCCGTATCTGGGATGACGAGGACTCGCCCGATGGAACACGCGAC
ATGGTCAGCGACTCTGCTGTTCGTTACGACGAGAACGGAGCCGAGATCAAGGCAGTCCAAGGATCTCGTCCTAGC
AAGAAGAAGGTGATGGAGGTCAACGAGACACAGATCATCAAGGCCAAGCTCGATTCTCCTTCGGGACCCAAGCTT
CGCAAGAAGAGCACAGAGCCGACAATGACGATTCACACCAGGGCGGCCACGGACGACATATACGACATATTCAAC
GCGCCTCTTCACAAGCCACGGGACAGTCCAGAGAGTGCTGATGAAGACGAGTACGAGACGGACGGCGACTATACG
ACCGACGCCGAGAGTACCGGCACGACGAGGCCTGTCGATGTCAGTCAGCAAGAGGACGAGGCGACGACGGCTGAC
GTCAAGAGCCCCGGAGAGTGGACTGGTGTTGTGGCTCTGCGGCCTGCGCTGGACGACGAGGGCAACGCCCGATAC
TCCAATGAGATACCGAAAGGTGCCTTCAACGGTCCAGATGTGGTCGAGAAGAAGCGTGAGGACGAGCAGCTGGCT
GAGTACGGAGATGACGACGACAATGGTAACGATGACGACGATAATAACGACGTCGACGACCAAGACATGGCCGAG
TCGATGCCGAGGACGCGAACCGTCTTCACTCCCTTACCCCCTGAAGACTACAACGCCCCAACTCGTCCGTATAGG
GATCCGGTCGAGGCGGCGAACTGTCGACTGCCGTTCATGACGCCCATCACGGAACGGACGGAGTGCTCTCTGGAT
GGGGAGACGGAACGCGAGAGACAGCAGCAGCTAGCCAAGACGCCGTCCAGGAGAGACGAGTACTCGTCCGTGAGC
CTCCTCCAGCGTCCTCAGAGTCCCGTCATCAAGGACAGGCGGTGCAATCCGGTCGACGAGGCGATTCGTCGTGAC
ATTCTGAACAGCCTCAGTCCTCCGCTGGCCTCGTATCACGGCTTCCACGATCGCAGAGAGGAGAGGTACGAGCGC
GGCTCTGAAATCCGCAAGTACATCAAGGCCGTGGGCAAGGCCGCCAAAGACAAGACCGCGACCAGCCCTGATGCT
CTCGTGCTTCGCTTCCCGGAGACGAGGGCCGCCTTCAGTCTCAAGCGAGAGCTGGGCGTCGGCGCATTTGCCCCC
GTCTACCTTGTCGAGAAGTCGATGCCGAACGAGGCCGAGGCTGACGATGAGGCCGGCTCCGACTTGAGCGCCGCC
AGTCGCCGCAGCAGGCTCGAGGCCCTCAAGATGGAATCGCCTCCATCTGCATGGGAGTTTCATATGATGCGCCTG
GTTCATGAGCGCCTGGTTCATGAGCGCCTGGGATCCGGACACCGAGTCGCGACGTCTCTTTCACACGCTCACGAG
TTGCACCTGTATCGAGACGAGGCCTTCCTCTTCCTCCCTTTTCACGCGCACGGCACGCTGCTCGACGTCGTCAAT
CTCTTCCGCGCCGAGCCCTCGGGCGTCATGGACGAGCTGCTGGCCATGTTCTTCGCCATCGAGCTACTGCGTACC
GTCGACGCCCTCCACGCAAAGGGCATCTTGCACGGCGACCTCAAGCCCGACAACTGCCTGCTCCGCGTGCCGGCC
GAACACCAGCCGCTGGAGACCCAATGGGAGGCGGACGGCGGCGGCGGCTGGGCGGCCAGGGGCGTCGTCCTCATC
GACTTTGGCCGCAGCATCGACATGATGGCCTTTTCATCCGACGTCGAGTTCATCGCCGACTGGAAGACGGGCCCT
CAGGACTGTCCCGAGATGCGCGAGAGCCGCCCGTGGACGTGGCAGATCGACTACCACGGCCTCGCCGCCACCATC
CACTGCCTGCTCTTCGGCAAGTACATGGAGACGACACGCTGTGATCAGGGCAACGTTTTGGGCAGCGCCGGCCGC
AGGTACAGAATCCGCGAGAGTCTGAAGCGTTACTGGCAGACGGACCTCTGGGCCGACCTCTTCGACATGCTGCTC
AACCCGCTCTCGTATGTAGATGGTGAACAAGCCGCGAGCATGCCGCTGCTCGGGGCCACGGCGAATCTTCGTCAC
CGAATGGAGCGCTGGCTTGAGGCCAATTGCGATAGGGGCGTCGGACTGCGGTCGCTCATGAGCAAGCTCGAGGCT
CATGCGAAGGAGTCGCAGACGAAGATGCCTCGGGCTCGATCGAAAGCATAG
Gene >Ophun1|2275
ATGCCGGACTCGGAGGATCTCATCAGCTTCGACGTGATCGAGGGGGAAAAGGAGAACATCCAGTCCCTTCCGGGG
GGACGATCAGCCAAGAAGCTCGCCGAGCTCGCGACTCTGGACCGCCACTCGCGACCGTCGTCGACAAAGACGGTC
AACGACTGCATTCGCATAGAATACGAGGCTGAGCTGGAAAACCTGGCCGAGTCGGATGACCCACTAGACGTCTTC
GACCGGTACGTCCGATGGACGCTCGATGCCTATCCTTCAGCGCAGGCGACGCCTCAGTCGCAGCTTCACACGCTG
CTCGAACGGGCGACGAAGGCGTTCATCTCTTCGACGACGTACCGCAATGATGCCCGCTATCTGAGGTTATGGATG
CATTACATTCACCTCTTCGCCGACGCGCCGCGCGAGACGTTCGTCTTTCTCTCGCGTCATGGCATCGGTGACTCG
CTGGCCCTGTTCTACGAGGAGTACGCGGCTTGGCTTGAGACGGCCGGCCGCTGGGCTCAGGCGGCTGAGGTCTAC
AGGCTCGGCATCGAGCGCGAGGCTCGTCCCCTTCAGCGGCTGGTGCGCAAGATGGATGAGTTTCAGGGGAGGCTT
GCGAAGCTGCCCGGAGAGACTATCGCCGATGCTCCCTCTTCTCCTGCTCTTCCAACGATGCGTCCGGCTCTGGCT
GCCAAATTGGATCCGTTTGCTTCGTCGTCGGTTGAGGCCGAGACGCAGCAGCCGCAGGCGACGGTCGCAGGCGCC
TCGCGCTCGTCCAGACCAAAGTTGGCAGTCTTCTCGGATACCGGAATGGAACCGGCCCCTGCTTCATTGTCTAGG
GGCGAAGGGTCCAAGGGATGGGATAACATCGGATCCCTCTCTGATCGCAAGAAGGAGAACACGATGAAGCCTACA
CCGTGGCTGGGAGAGACGCTGAAAGCTGGCGGCAGCAAGGCGAGGACGGCCAAGATGAACGTCTTCAGGGATGCG
GTAGGTTCTCCAGTCCCAATGCCTATTCCCATTTCCCCAACGCCCCTGTTTGCCTGCAGAACAACCGTCCGTATG
TTGATGACGACAGGACTGAATATTGTGGCTGATGGCTTTTCTTCTACTTTTTTATCTGCTGTACCTCAGTCGCTC
TCGAAAATAAACAACTTTGTTGTCGTCCCTTCGAGGGATCAAGTGACGATCCACCCTCAAACGGGCAAGAAGGAA
ACCATCTTTGTCGATCTCGCAGCTCTATATCCGACACCAGAGCTTCTCGGAACGGAATTGAGCTTCGAAGAAATC
ATGGCAGCAAAGCGAGGATGGCTTCCCCGTATCTGGGATGACGAGGACTCGCCCGATGGAACACGCGACATGGTC
AGCGACTCTGCTGTTCGTTACGACGAGAACGGAGCCGAGATCAAGGCAGTCCAAGGATCTCGTCCTAGCAAGAAG
AAGGTGATGGAGGTCAACGAGACACAGATCAGTGAGTGTCCTCCTTGGTATAATCTGATCTGTCTTATTCTCCGT
TGTTGCTGACGAGCCACCAGTCAAGGCCAAGCTCGATTCTCCTTCGGGACCCAAGCTTCGCAAGAAGAGCACAGA
GCCGACAATGACGATTCACACCAGGGCGGCCACGGACGACATATACGACATATTCAACGCGCCTCTTCACAAGCC
ACGGGACAGTCCAGAGAGTGCTGATGAAGACGAGTACGAGACGGACGGCGACTATACGACCGACGCCGAGAGTAC
CGGCACGACGAGGCCTGTCGATGTCAGTCAGCAAGAGGACGAGGCGACGACGGCTGACGTCAAGAGCCCCGGAGA
GTGGACTGGTGTTGTGGCTCTGCGGCCTGCGCTGGACGACGAGGGCAACGCCCGATACTCCAATGAGATACCGAA
AGGTGCCTTCAACGGTCCAGATGTGGTCGAGAAGAAGCGTGAGGACGAGCAGCTGGCTGAGTACGGAGATGACGA
CGACAATGGTAACGATGACGACGATAATAACGACGTCGACGACCAAGACATGGCCGAGTCGATGCCGAGGACGCG
AACCGTCTTCACTCCCTTACCCCCTGAAGACTACAACGCCCCAACTCGTCCGTATAGGGATCCGGTCGAGGCGGC
GAACTGTCGACTGCCGTTCATGACGCCCATCACGGAACGGACGGAGTGCTCTCTGGATGGGGAGACGGAACGCGA
GAGACAGCAGCAGCTAGCCAAGACGCCGTCCAGGAGAGACGAGTACTCGTCCGTGAGCCTCCTCCAGCGTCCTCA
GAGTCCCGTCATCAAGGACAGGCGGTGCAATCCGGTCGACGAGGCGATTCGTCGTGACATTCTGAACAGCCTCAG
TCCTCCGCTGGCCTCGTATCACGGCTTCCACGATCGCAGAGAGGAGAGGTACGAGCGCGGCTCTGAAATCCGCAA
GTACATCAAGGCCGTGGGCAAGGCCGCCAAAGACAAGACCGCGACCAGCCCTGATGCTCTCGTGCTTCGCTTCCC
GGAGACGAGGGCCGCCTTCAGTCTCAAGCGAGAGCTGGGCGTCGGCGCATTTGCCCCCGTCTACCTTGTCGAGAA
GTCGATGCCGAACGAGGCCGAGGCTGACGATGAGGCCGGCTCCGACTTGAGCGCCGCCAGTCGCCGCAGCAGGCT
CGAGGCCCTCAAGATGGAATCGCCTCCATCTGCATGGGAGTTTCATATGATGCGCCTGGTTCATGAGCGCCTGGT
TCATGAGCGCCTGGGATCCGGACACCGAGTCGCGACGTCTCTTTCACACGCTCACGAGTTGCACCTGTATCGAGA
CGAGGCCTTCCTCTTCCTCCCTTTTCACGCGCACGGCACGCTGCTCGACGTCGTCAATCTCTTCCGCGCCGAGCC
CTCGGGCGTCATGGACGAGCTGCTGGCCATGTTCTTCGCCATCGAGCTACTGCGTACCGTCGACGCCCTCCACGC
AAAGGGCATCTTGCACGGCGACCTCAAGCCCGACAACTGCCTGCTCCGCGTGCCGGCCGAACACCAGCCGCTGGA
GACCCAATGGGAGGCGGACGGCGGCGGCGGCTGGGCGGCCAGGGGCGTCGTCCTCATCGACTTTGGCCGCAGCAT
CGACATGATGGCCTTTTCATCCGACGTCGAGTTCATCGCCGACTGGAAGACGGGCCCTCAGGACTGTCCCGAGAT
GCGCGAGAGCCGCCCGTGGACGTGGCAGATCGACTACCACGGCCTCGCCGCCACCATCCACTGCCTGCTCTTCGG
CAAGTACATGGAGACGACACGCTGTGATCAGGGCAACGTTTTGGGCAGCGCCGGCCGCAGGTACAGAATCCGCGA
GAGTCTGAAGCGTTACTGGCAGACGGACCTCTGGGCCGACCTCTTCGACATGCTGCTCAACCCGCTCTCGTATGT
AGATGGTGAACAAGCCGCGAGCATGCCGCTGCTCGGGGCCACGGCGAATCTTCGTCACCGAATGGAGCGCTGGCT
TGAGGCCAATTGCGATAGGGGCGTCGGACTGCGGTCGCTCATGAGCAAGCTCGAGGCTCATGCGAAGGAGTCGCA
GACGAAGATGCCTCGGGCTCGATCGAAAGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail