Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2272
Gene name
LocationContig_21:11428..13744
Strand-
Gene length (bp)2316
Transcript length (bp)2316
Coding sequence length (bp)2316
Protein length (aa) 772

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04408 HA2 Helicase associated domain (HA2) 1.7E-16 531 620
PF00271 Helicase_C Helicase conserved C-terminal domain 4.5E-12 346 469
PF07717 OB_NTP_bind Oligonucleotide/oligosaccharide-binding (OB)-fold 9.7E-10 695 765

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03319|PRH1_SCHPO Probable ATP-dependent RNA helicase prh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prh1 PE=3 SV=2 84 763 3.0E-172
sp|Q9H6R0|DHX33_HUMAN Putative ATP-dependent RNA helicase DHX33 OS=Homo sapiens GN=DHX33 PE=1 SV=2 97 771 7.0E-144
sp|F4IE66|PRP22_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10 OS=Arabidopsis thaliana GN=RID1 PE=1 SV=1 98 765 3.0E-142
sp|Q80VY9|DHX33_MOUSE Putative ATP-dependent RNA helicase DHX33 OS=Mus musculus GN=Dhx33 PE=1 SV=1 97 766 3.0E-140
sp|P36009|DHR2_YEAST Probable ATP-dependent RNA helicase DHR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DHR2 PE=1 SV=1 75 767 2.0E-136
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03319|PRH1_SCHPO Probable ATP-dependent RNA helicase prh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prh1 PE=3 SV=2 84 763 3.0E-172
sp|Q9H6R0|DHX33_HUMAN Putative ATP-dependent RNA helicase DHX33 OS=Homo sapiens GN=DHX33 PE=1 SV=2 97 771 7.0E-144
sp|F4IE66|PRP22_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10 OS=Arabidopsis thaliana GN=RID1 PE=1 SV=1 98 765 3.0E-142
sp|Q80VY9|DHX33_MOUSE Putative ATP-dependent RNA helicase DHX33 OS=Mus musculus GN=Dhx33 PE=1 SV=1 97 766 3.0E-140
sp|P36009|DHR2_YEAST Probable ATP-dependent RNA helicase DHR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DHR2 PE=1 SV=1 75 767 2.0E-136
sp|Q9LZQ9|DEAH2_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH2 OS=Arabidopsis thaliana GN=At3g62310 PE=2 SV=1 77 771 5.0E-135
sp|O22899|PRP43_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH3 OS=Arabidopsis thaliana GN=At2g47250 PE=2 SV=1 95 771 6.0E-135
sp|O35286|DHX15_MOUSE Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Mus musculus GN=Dhx15 PE=1 SV=2 92 771 3.0E-131
sp|Q5RAZ4|DHX15_PONAB Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Pongo abelii GN=DHX15 PE=2 SV=2 92 771 4.0E-131
sp|O43143|DHX15_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens GN=DHX15 PE=1 SV=2 92 771 4.0E-131
sp|Q8VY00|ESP3_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1 OS=Arabidopsis thaliana GN=ESP3 PE=1 SV=1 98 765 3.0E-130
sp|O42945|DHX15_SCHPO Probable pre-mRNA-splicing factor ATP-dependent RNA helicase prp43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp43 PE=3 SV=1 84 771 5.0E-128
sp|F4IJV4|DEAH6_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6 OS=Arabidopsis thaliana GN=MEE29 PE=2 SV=1 98 771 2.0E-127
sp|Q9H5Z1|DHX35_HUMAN Probable ATP-dependent RNA helicase DHX35 OS=Homo sapiens GN=DHX35 PE=1 SV=2 96 765 6.0E-127
sp|F4JMJ3|DEAH8_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH8 OS=Arabidopsis thaliana GN=At4g16680 PE=2 SV=2 98 771 8.0E-127
sp|Q10752|CDC28_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein cdc28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc28 PE=3 SV=2 98 765 6.0E-126
sp|Q5RBD4|DHX35_PONAB Probable ATP-dependent RNA helicase DHX35 OS=Pongo abelii GN=DHX35 PE=2 SV=1 96 771 6.0E-126
sp|Q20875|DHX15_CAEEL Pre-mRNA-splicing factor ATP-dependent RNA helicase ddx-15 OS=Caenorhabditis elegans GN=ddx-15 PE=3 SV=1 97 771 7.0E-125
sp|Q38953|DEAH5_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2 97 765 4.0E-124
sp|P53131|PRP43_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP43 PE=1 SV=1 95 765 8.0E-124
sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 93 765 2.0E-120
sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 95 765 2.0E-120
sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 95 765 3.0E-120
sp|O45244|DHX16_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 OS=Caenorhabditis elegans GN=mog-4 PE=1 SV=2 98 771 2.0E-119
sp|Q09530|MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans GN=mog-5 PE=1 SV=1 95 765 3.0E-119
sp|O60231|DHX16_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens GN=DHX16 PE=1 SV=2 98 771 5.0E-118
sp|Q7YR39|DHX16_PANTR Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Pan troglodytes GN=DHX16 PE=3 SV=1 98 771 5.0E-118
sp|O42643|PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp22 PE=1 SV=1 95 765 2.0E-117
sp|P20095|PRP2_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein PRP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP2 PE=1 SV=1 98 767 2.0E-117
sp|P15938|PRP16_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP16 PE=1 SV=2 98 765 5.0E-117
sp|Q767K6|DHX16_PIG Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Sus scrofa GN=DHX16 PE=3 SV=1 98 771 5.0E-117
sp|Q54MH3|DHX16_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Dictyostelium discoideum GN=dhx16 PE=3 SV=1 98 765 1.0E-116
sp|Q54NJ4|DHX15_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase dhx15 OS=Dictyostelium discoideum GN=dhx15 PE=3 SV=1 78 765 7.0E-116
sp|P24384|PRP22_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP22 PE=1 SV=1 97 771 2.0E-115
sp|F4K2E9|PRP16_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH7 OS=Arabidopsis thaliana GN=CUV PE=1 SV=1 97 765 2.0E-114
sp|Q92620|PRP16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens GN=DHX38 PE=1 SV=2 95 765 2.0E-114
sp|F4JRJ6|DEAH9_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH9 OS=Arabidopsis thaliana GN=At4g18465 PE=3 SV=1 96 771 3.0E-114
sp|Q9BKQ8|DHX35_CAEEL Probable ATP-dependent RNA helicase DHX35 homolog OS=Caenorhabditis elegans GN=Y67D2.6 PE=3 SV=1 96 771 4.0E-114
sp|Q17R09|PRP16_BOVIN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Bos taurus GN=DHX38 PE=2 SV=1 95 765 5.0E-114
sp|P34498|MOG1_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 OS=Caenorhabditis elegans GN=mog-1 PE=1 SV=2 96 765 1.0E-113
sp|Q9P774|PRP16_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp16 PE=3 SV=2 96 765 1.0E-112
sp|Q9HE06|YK99_SCHPO Putative pre-mRNA-splicing factor ATP-dependent RNA helicase C20H4.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20H4.09 PE=3 SV=1 97 763 4.0E-111
sp|Q8IX18|DHX40_HUMAN Probable ATP-dependent RNA helicase DHX40 OS=Homo sapiens GN=DHX40 PE=1 SV=2 101 767 2.0E-106
sp|Q5R864|DHX40_PONAB Probable ATP-dependent RNA helicase DHX40 OS=Pongo abelii GN=DHX40 PE=2 SV=1 101 767 4.0E-106
sp|Q5XI69|DHX40_RAT Probable ATP-dependent RNA helicase DHX40 OS=Rattus norvegicus GN=Dhx40 PE=2 SV=1 101 767 6.0E-106
sp|Q6PE54|DHX40_MOUSE Probable ATP-dependent RNA helicase DHX40 OS=Mus musculus GN=Dhx40 PE=1 SV=1 101 767 1.0E-105
sp|Q93Y16|DEAH4_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4 OS=Arabidopsis thaliana GN=At1g27900 PE=1 SV=1 101 763 3.0E-102
sp|P45018|HRPA_HAEIN ATP-dependent RNA helicase HrpA homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hrpA PE=3 SV=2 101 763 4.0E-93
sp|O17438|DHX15_STRPU Putative pre-mRNA-splicing factor ATP-dependent RNA helicase PRP1 (Fragment) OS=Strongylocentrotus purpuratus GN=PRP1 PE=2 SV=1 216 662 3.0E-89
sp|Q14147|DHX34_HUMAN Probable ATP-dependent RNA helicase DHX34 OS=Homo sapiens GN=DHX34 PE=1 SV=2 96 673 1.0E-87
sp|P43329|HRPA_ECOLI ATP-dependent RNA helicase HrpA OS=Escherichia coli (strain K12) GN=hrpA PE=3 SV=3 101 763 3.0E-84
sp|Q9DBV3|DHX34_MOUSE Probable ATP-dependent RNA helicase DHX34 OS=Mus musculus GN=Dhx34 PE=1 SV=2 96 673 8.0E-84
sp|Q9HDY4|YK16_SCHPO Putative ATP-dependent RNA helicase PB1A10.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A10.06c PE=3 SV=1 89 665 1.0E-82
sp|P0CE10|DEAHB_ARATH ATP-dependent RNA helicase DEAH11, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=3 SV=1 101 758 1.0E-77
sp|F4KGU4|DEAHC_ARATH ATP-dependent RNA helicase DEAH12, chloroplastic OS=Arabidopsis thaliana GN=At5g10370 PE=3 SV=1 101 757 2.0E-74
sp|F4IM84|DEXH5_ARATH DExH-box ATP-dependent RNA helicase DExH5, mitochondrial OS=Arabidopsis thaliana GN=At2g01130 PE=3 SV=1 93 676 2.0E-63
sp|F4HYJ7|DEXH3_ARATH DExH-box ATP-dependent RNA helicase DExH3 OS=Arabidopsis thaliana GN=At1g48650 PE=2 SV=1 76 672 8.0E-59
sp|Q924H9|DQX1_MOUSE ATP-dependent RNA helicase DQX1 OS=Mus musculus GN=Dqx1 PE=2 SV=1 95 765 3.0E-57
sp|Q8BZS9|DHX32_MOUSE Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Mus musculus GN=Dhx32 PE=1 SV=2 86 771 4.0E-56
sp|Q7L7V1|DHX32_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Homo sapiens GN=DHX32 PE=1 SV=1 86 771 2.0E-55
sp|Q5XH12|DHX32_XENLA Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Xenopus laevis GN=dhx32 PE=2 SV=1 86 771 5.0E-54
sp|Q28141|DHX9_BOVIN ATP-dependent RNA helicase A OS=Bos taurus GN=DHX9 PE=2 SV=1 95 730 2.0E-52
sp|Q5R874|DHX9_PONAB ATP-dependent RNA helicase A OS=Pongo abelii GN=DHX9 PE=2 SV=1 95 730 1.0E-51
sp|Q08211|DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 95 730 1.0E-51
sp|P37024|HRPB_ECOLI ATP-dependent RNA helicase HrpB OS=Escherichia coli (strain K12) GN=hrpB PE=3 SV=3 122 570 3.0E-51
sp|Q9C6G0|DEXH4_ARATH DExH-box ATP-dependent RNA helicase DExH4, chloroplastic OS=Arabidopsis thaliana GN=At1g58050 PE=3 SV=1 95 764 6.0E-51
sp|Q5ZI74|DHX30_CHICK Putative ATP-dependent RNA helicase DHX30 OS=Gallus gallus GN=DHX30 PE=2 SV=1 101 588 4.0E-50
sp|B4LX81|SPNE_DROVI Probable ATP-dependent RNA helicase spindle-E OS=Drosophila virilis GN=spn-E PE=3 SV=1 95 675 5.0E-49
sp|B4JT42|SPNE_DROGR Probable ATP-dependent RNA helicase spindle-E OS=Drosophila grimshawi GN=spn-E PE=3 SV=1 95 675 8.0E-49
sp|O94536|UCP12_SCHPO Putative ATP-dependent RNA helicase ucp12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ucp12 PE=3 SV=1 95 662 1.0E-48
sp|Q5BJS0|DHX30_RAT Putative ATP-dependent RNA helicase DHX30 OS=Rattus norvegicus GN=Dhx30 PE=1 SV=1 98 588 2.0E-48
sp|Q99PU8|DHX30_MOUSE Putative ATP-dependent RNA helicase DHX30 OS=Mus musculus GN=Dhx30 PE=1 SV=1 98 588 2.0E-48
sp|Q7L2E3|DHX30_HUMAN Putative ATP-dependent RNA helicase DHX30 OS=Homo sapiens GN=DHX30 PE=1 SV=1 98 588 5.0E-48
sp|B3P3W1|SPNE_DROER Probable ATP-dependent RNA helicase spindle-E OS=Drosophila erecta GN=spn-E PE=3 SV=1 57 700 5.0E-48
sp|O70133|DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus GN=Dhx9 PE=1 SV=2 66 730 9.0E-48
sp|Q3ZBE0|DQX1_BOVIN ATP-dependent RNA helicase DQX1 OS=Bos taurus GN=DQX1 PE=2 SV=1 86 747 1.0E-47
sp|Q5R607|DHX30_PONAB Putative ATP-dependent RNA helicase DHX30 OS=Pongo abelii GN=DHX30 PE=2 SV=1 98 588 1.0E-47
sp|Q2NKY8|DHX30_BOVIN Putative ATP-dependent RNA helicase DHX30 OS=Bos taurus GN=DHX30 PE=2 SV=1 98 588 1.0E-47
sp|B4PRJ9|SPNE_DROYA Probable ATP-dependent RNA helicase spindle-E OS=Drosophila yakuba GN=spn-E PE=3 SV=1 95 700 3.0E-47
sp|B4NBB0|SPNE_DROWI Probable ATP-dependent RNA helicase spindle-E OS=Drosophila willistoni GN=spn-E PE=3 SV=1 95 668 5.0E-47
sp|B4K5R2|SPNE_DROMO Probable ATP-dependent RNA helicase spindle-E OS=Drosophila mojavensis GN=spn-E PE=3 SV=1 95 666 3.0E-46
sp|O60114|YG65_SCHPO Uncharacterized helicase C15C4.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.05 PE=3 SV=1 98 664 3.0E-46
sp|B4HLH4|SPNE_DROSE Probable ATP-dependent RNA helicase spindle-E OS=Drosophila sechellia GN=spn-E PE=3 SV=1 95 700 3.0E-46
sp|Q06698|YL419_YEAST Putative ATP-dependent RNA helicase YLR419W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR419W PE=1 SV=1 98 717 4.0E-46
sp|B8A4F4|TDRD9_DANRE Putative ATP-dependent RNA helicase TDRD9 OS=Danio rerio GN=tdrd9 PE=2 SV=1 58 700 6.0E-46
sp|Q296Q5|SPNE_DROPS Probable ATP-dependent RNA helicase spindle-E OS=Drosophila pseudoobscura pseudoobscura GN=spn-E PE=3 SV=2 40 672 2.0E-45
sp|Q8TE96|DQX1_HUMAN ATP-dependent RNA helicase DQX1 OS=Homo sapiens GN=DQX1 PE=2 SV=2 86 747 4.0E-45
sp|Q9VF26|SPNE_DROME Probable ATP-dependent RNA helicase spindle-E OS=Drosophila melanogaster GN=spn-E PE=2 SV=1 95 680 5.0E-45
sp|B4GEU5|SPNE_DROPE Probable ATP-dependent RNA helicase spindle-E OS=Drosophila persimilis GN=spn-E PE=3 SV=1 95 672 7.0E-45
sp|P24785|MLE_DROME Dosage compensation regulator OS=Drosophila melanogaster GN=mle PE=1 SV=2 87 595 1.0E-44
sp|B0XDC4|SPNE_CULQU Probable ATP-dependent RNA helicase spindle-E OS=Culex quinquefasciatus GN=spn-E PE=3 SV=1 97 700 5.0E-44
sp|B3M383|SPNE_DROAN Probable ATP-dependent RNA helicase spindle-E OS=Drosophila ananassae GN=spn-E PE=3 SV=1 95 673 6.0E-44
sp|Q7QCW2|SPNE_ANOGA Probable ATP-dependent RNA helicase spindle-E OS=Anopheles gambiae GN=spn-E PE=3 SV=5 31 670 3.0E-43
sp|Q8NDG6|TDRD9_HUMAN Putative ATP-dependent RNA helicase TDRD9 OS=Homo sapiens GN=TDRD9 PE=2 SV=3 97 595 1.0E-42
sp|Q16JS8|SPNE_AEDAE Probable ATP-dependent RNA helicase spindle-E OS=Aedes aegypti GN=spn-E PE=3 SV=1 54 663 2.0E-42
sp|Q04217|DHR1_YEAST Probable ATP-dependent RNA helicase DHR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM16 PE=1 SV=1 96 360 6.0E-42
sp|Q3MHU3|TDRD9_RAT Putative ATP-dependent RNA helicase TDRD9 OS=Rattus norvegicus GN=Tdrd9 PE=2 SV=3 92 675 1.0E-41
sp|Q14BI7|TDRD9_MOUSE Putative ATP-dependent RNA helicase TDRD9 OS=Mus musculus GN=Tdrd9 PE=1 SV=3 92 664 2.0E-41
sp|Q5UQ96|YL540_MIMIV Putative ATP-dependent RNA helicase L540 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L540 PE=1 SV=1 122 657 2.0E-40
sp|Q9H2U1|DHX36_HUMAN ATP-dependent RNA helicase DHX36 OS=Homo sapiens GN=DHX36 PE=1 SV=2 62 730 2.0E-40
sp|Q8VHK9|DHX36_MOUSE ATP-dependent RNA helicase DHX36 OS=Mus musculus GN=Dhx36 PE=1 SV=2 63 730 2.0E-39
sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens GN=DHX37 PE=1 SV=1 89 362 3.0E-39
sp|Q04217|DHR1_YEAST Probable ATP-dependent RNA helicase DHR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM16 PE=1 SV=1 383 592 8.0E-38
sp|O46072|KZ_DROME Probable ATP-dependent RNA helicase kurz OS=Drosophila melanogaster GN=kz PE=1 SV=1 98 399 5.0E-37
sp|Q9C813|DEAHD_ARATH ATP-dependent RNA helicase DEAH13 OS=Arabidopsis thaliana GN=FAS4 PE=2 SV=1 98 361 8.0E-37
sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens GN=DHX37 PE=1 SV=1 381 763 2.0E-36
sp|Q9C813|DEAHD_ARATH ATP-dependent RNA helicase DEAH13 OS=Arabidopsis thaliana GN=FAS4 PE=2 SV=1 380 568 1.0E-35
sp|P34305|RHA2_CAEEL Putative ATP-dependent RNA helicase rha-2 OS=Caenorhabditis elegans GN=rha-2 PE=3 SV=2 96 361 3.0E-35
sp|Q1EHT7|C3H4_ORYSJ Zinc finger CCCH domain-containing protein 4 OS=Oryza sativa subsp. japonica GN=Os01g0256800 PE=2 SV=1 123 569 6.0E-35
sp|F4ILR7|DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana GN=At2g35920 PE=2 SV=1 348 730 1.0E-34
sp|F4I9Q5|DEXH7_ARATH DExH-box ATP-dependent RNA helicase DExH7, chloroplastic OS=Arabidopsis thaliana GN=At1g58060 PE=2 SV=1 348 756 1.0E-32
sp|O22243|C3H31_ARATH DExH-box ATP-dependent RNA helicase DExH8 OS=Arabidopsis thaliana GN=At2g47680 PE=2 SV=2 123 516 1.0E-31
sp|P34305|RHA2_CAEEL Putative ATP-dependent RNA helicase rha-2 OS=Caenorhabditis elegans GN=rha-2 PE=3 SV=2 386 763 4.0E-31
sp|Q6P158|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2 347 673 4.0E-31
sp|Q6P5D3|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=1 SV=2 347 673 2.0E-30
sp|Q6PGC1|DHX29_MOUSE ATP-dependent RNA helicase Dhx29 OS=Mus musculus GN=Dhx29 PE=1 SV=1 93 360 3.0E-30
sp|Q7Z478|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2 93 360 5.0E-30
sp|A3KMI0|DHX29_XENLA ATP-dependent RNA helicase DHX29 OS=Xenopus laevis GN=dhx29 PE=2 SV=1 93 360 5.0E-30
sp|P0C9A4|H962L_ASFK5 Putative RNA Helicase B962L OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-084 PE=3 SV=1 94 592 2.0E-29
sp|Q8V9U2|H962L_ASFM2 Putative RNA Helicase B962L OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-080 PE=3 SV=1 118 532 3.0E-29
sp|Q89443|H962L_ASFB7 Putative RNA helicase B962L OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-072 PE=3 SV=1 118 592 4.0E-29
sp|A3KMI0|DHX29_XENLA ATP-dependent RNA helicase DHX29 OS=Xenopus laevis GN=dhx29 PE=2 SV=1 348 730 6.0E-29
sp|F4IDQ6|NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana GN=NIH PE=1 SV=1 328 672 7.0E-29
sp|P0C9A2|H962L_ASFP4 Putative RNA Helicase B962L OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-084 PE=3 SV=1 118 592 1.0E-28
sp|P0C9A3|H962L_ASFWA Putative RNA Helicase B962L OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-082 PE=3 SV=1 118 592 1.0E-28
sp|Q6PGC1|DHX29_MOUSE ATP-dependent RNA helicase Dhx29 OS=Mus musculus GN=Dhx29 PE=1 SV=1 346 675 3.0E-27
sp|Q7Z478|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2 346 671 4.0E-27
sp|O46072|KZ_DROME Probable ATP-dependent RNA helicase kurz OS=Drosophila melanogaster GN=kz PE=1 SV=1 383 764 5.0E-26
sp|Q68FK8|DHX9_XENLA ATP-dependent RNA helicase A-like protein OS=Xenopus laevis GN=dhx9 PE=2 SV=1 309 730 1.0E-25
sp|F4I9Q5|DEXH7_ARATH DExH-box ATP-dependent RNA helicase DExH7, chloroplastic OS=Arabidopsis thaliana GN=At1g58060 PE=2 SV=1 95 317 5.0E-25
sp|Q6P158|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2 95 334 2.0E-24
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 348 764 1.0E-23
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 348 764 2.0E-23
sp|Q5UR20|YR366_MIMIV Putative ATP-dependent RNA helicase R366 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R366 PE=3 SV=1 121 580 3.0E-23
sp|Q68FK8|DHX9_XENLA ATP-dependent RNA helicase A-like protein OS=Xenopus laevis GN=dhx9 PE=2 SV=1 87 338 2.0E-22
sp|Q22307|DHX9_CAEEL Probable ATP-dependent RNA helicase A OS=Caenorhabditis elegans GN=rha-1 PE=2 SV=3 97 345 3.0E-22
sp|F4ILR7|DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana GN=At2g35920 PE=2 SV=1 98 340 5.0E-22
sp|Q6P5D3|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=1 SV=2 95 333 7.0E-22
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 79 322 2.0E-21
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 98 322 2.0E-21
sp|P0C7L7|YUM14_USTMA Putative DEAH-box ATP-dependent helicase UM11114 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11114 PE=3 SV=1 98 339 1.0E-20
sp|F4INY4|HVT1_ARATH DExH-box ATP-dependent RNA helicase DExH6 OS=Arabidopsis thaliana GN=HVT1 PE=2 SV=1 348 570 2.0E-20
sp|P0C7L7|YUM14_USTMA Putative DEAH-box ATP-dependent helicase UM11114 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11114 PE=3 SV=1 348 692 3.0E-20
sp|F4INY4|HVT1_ARATH DExH-box ATP-dependent RNA helicase DExH6 OS=Arabidopsis thaliana GN=HVT1 PE=2 SV=1 98 374 1.0E-19
sp|F4IDQ6|NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana GN=NIH PE=1 SV=1 98 317 9.0E-18
sp|Q22307|DHX9_CAEEL Probable ATP-dependent RNA helicase A OS=Caenorhabditis elegans GN=rha-1 PE=2 SV=3 348 589 5.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0004386 helicase activity Yes
GO:0140657 ATP-dependent activity No
GO:0003674 molecular_function No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1728
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5500
Ophiocordyceps australis map64 (Brazil) OphauB2|5559
Ophiocordyceps camponoti-floridani Ophcf2|00102
Ophiocordyceps camponoti-rufipedis Ophun1|2272 (this protein)
Ophiocordyceps kimflemingae Ophio5|398
Ophiocordyceps subramaniannii Hirsu2|1574

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2272
MASTDTQRTPKRLKRLHDTSFVTLGGKTISLEGYLDSSPKPAKALPLAQPLTNSIADSPEEKRAEADRSKERRPQ
RSKGNGTLDAPQDTRDPRWLRKRRELPIWQHRSEIQAALRDPASNALVIVGETGSGKSTQVPQFLYRESWCRRIK
TRLPNSQDELHVGGVIAITQPRRVAATSLAYRVSQEVETPLDKRTKDGLVGYAVRFDHRVPRGTKIKFLTEGTLL
QELLRDPNLRSYSAIVVDEIHERSLNVDILMGFLKQILTGDLRGRGGVPLKIVVMSATADVRVFQDFLSDNSKTD
AENLVRVLQIQGRQFPVEMIHEPQPVADVEDALQRRIFKLHMEEPLPGDILAFLTGQEEIESAETLIDEFAATLA
SDVPRIKVCALYGQLSMERQREAFLPAETSFTRKVILATNIAETSVTVPGVRYVIDCGKAKIKKYRPRLGMESLL
PKAISKSSALQRAGRAGREGPGKCFRLYTESTFQSFQAAELPEILRNDVVGAVLTMKAHGISDISAFPLLDAPGT
KSTERALLQLHFLGALSDDGVITPAGAQMARFPIPAPFSAVLLAAARPGFDCVTEVIDIISCIASGDDIFLRLKS
EEAQEQAGQLRRELQRREGDLLTYLTTMQRYTAENTDRTEWCRKRLINLRNMRQALNIRRQLRSLCVKEGLLAPP
PPDPQPFSPASPERADVILRCFVRGFATKTAMLAPDGSYVTTQGKHVVAIHPASVLHGQKREAIMFLEHVFTNKS
YAKKVSALRADWIVEALEERY*
Coding >Ophun1|2272
ATGGCCTCAACTGATACACAGCGGACGCCCAAACGGCTCAAAAGACTCCACGACACCAGTTTCGTGACTCTCGGT
GGCAAAACCATCTCTCTCGAAGGATACTTGGACTCGTCACCCAAGCCGGCCAAGGCTCTCCCTCTCGCTCAGCCT
TTGACGAACTCGATCGCCGATAGCCCAGAGGAGAAGAGAGCCGAGGCGGATCGCTCGAAAGAGAGAAGGCCACAG
AGGTCCAAAGGGAACGGAACCCTCGACGCTCCACAAGATACACGAGATCCTAGGTGGCTGCGAAAGCGCAGAGAG
CTCCCGATATGGCAGCATCGATCGGAAATACAGGCTGCATTGCGCGACCCTGCGAGCAACGCTCTGGTCATCGTC
GGCGAGACAGGCTCGGGAAAGAGTACTCAAGTACCCCAGTTCCTATACAGAGAGTCATGGTGTCGTCGCATCAAG
ACCCGACTACCAAATTCCCAAGACGAGTTGCACGTTGGTGGAGTCATCGCCATTACCCAGCCACGGCGCGTCGCG
GCAACCAGCTTGGCCTATCGGGTATCTCAAGAAGTCGAAACGCCCCTGGACAAGAGGACGAAAGACGGCTTGGTC
GGTTACGCCGTTCGATTCGACCATCGTGTCCCGCGCGGGACCAAGATCAAGTTTCTCACAGAGGGCACGCTTCTT
CAAGAGCTCCTTCGGGACCCGAACCTGCGCAGTTACAGCGCCATAGTCGTTGACGAGATCCACGAAAGAAGCTTG
AACGTGGATATTCTGATGGGTTTCTTGAAGCAGATCCTGACAGGAGACCTCCGTGGTCGTGGGGGGGTCCCACTG
AAGATTGTCGTCATGAGCGCCACTGCAGACGTGCGCGTTTTCCAGGACTTCCTCAGCGACAATTCCAAGACTGAT
GCAGAAAACCTAGTACGGGTTCTGCAGATTCAGGGCCGACAGTTTCCCGTGGAGATGATACACGAGCCGCAACCG
GTAGCCGACGTGGAAGATGCCCTCCAGCGAAGGATTTTCAAATTACACATGGAAGAACCCCTTCCCGGAGATATC
CTGGCCTTTCTCACGGGCCAGGAGGAGATTGAATCGGCCGAGACGCTCATCGACGAGTTTGCTGCGACATTGGCT
TCTGATGTGCCGAGAATCAAAGTGTGCGCTTTGTACGGGCAGCTGTCCATGGAAAGGCAGCGAGAAGCCTTTTTA
CCCGCCGAGACCTCCTTTACCCGAAAAGTCATACTGGCCACCAACATTGCCGAAACCTCGGTTACGGTCCCCGGC
GTGCGGTACGTGATAGACTGCGGCAAGGCCAAAATCAAGAAGTATCGACCTCGGCTTGGCATGGAATCATTGCTG
CCCAAGGCTATCTCAAAGTCATCGGCTCTACAGCGAGCCGGTAGAGCTGGCCGTGAGGGTCCCGGAAAATGCTTC
AGGCTTTACACAGAAAGCACATTCCAATCATTCCAGGCGGCAGAGCTCCCCGAGATACTTCGCAACGACGTGGTC
GGGGCCGTCCTCACCATGAAGGCGCACGGCATTAGCGACATCTCGGCGTTTCCCTTACTAGACGCACCGGGGACG
AAGTCGACCGAGAGGGCCCTGCTTCAGCTTCACTTCCTCGGCGCGCTCTCCGATGACGGTGTCATCACTCCTGCG
GGCGCCCAGATGGCTAGATTTCCGATCCCCGCTCCCTTCAGCGCGGTGCTCCTCGCGGCCGCCCGTCCCGGATTC
GACTGCGTTACTGAGGTCATCGACATCATCTCGTGCATCGCGTCGGGAGACGACATATTTCTTCGGCTCAAGTCC
GAGGAAGCCCAAGAGCAAGCGGGTCAGCTGCGAAGAGAGCTGCAGAGACGAGAGGGTGACCTCTTGACGTACCTC
ACTACCATGCAGCGTTATACGGCCGAGAACACGGATCGGACTGAGTGGTGTAGGAAGAGGCTAATCAATTTGCGC
AACATGCGACAGGCCTTGAATATTCGGAGGCAACTTCGCAGCCTCTGTGTCAAAGAGGGTCTGTTGGCTCCCCCG
CCTCCGGACCCGCAGCCCTTCTCGCCTGCGAGCCCGGAGAGGGCCGACGTGATCTTGAGGTGCTTCGTGCGAGGC
TTCGCGACCAAGACAGCGATGCTAGCACCAGATGGGAGCTATGTTACCACACAGGGCAAACACGTGGTCGCTATC
CATCCGGCCAGCGTCTTGCACGGGCAGAAAAGGGAGGCTATCATGTTTCTCGAGCACGTGTTTACTAACAAGAGC
TATGCGAAGAAGGTCAGCGCCCTGCGAGCTGACTGGATCGTCGAAGCACTAGAAGAGAGATATTAG
Transcript >Ophun1|2272
ATGGCCTCAACTGATACACAGCGGACGCCCAAACGGCTCAAAAGACTCCACGACACCAGTTTCGTGACTCTCGGT
GGCAAAACCATCTCTCTCGAAGGATACTTGGACTCGTCACCCAAGCCGGCCAAGGCTCTCCCTCTCGCTCAGCCT
TTGACGAACTCGATCGCCGATAGCCCAGAGGAGAAGAGAGCCGAGGCGGATCGCTCGAAAGAGAGAAGGCCACAG
AGGTCCAAAGGGAACGGAACCCTCGACGCTCCACAAGATACACGAGATCCTAGGTGGCTGCGAAAGCGCAGAGAG
CTCCCGATATGGCAGCATCGATCGGAAATACAGGCTGCATTGCGCGACCCTGCGAGCAACGCTCTGGTCATCGTC
GGCGAGACAGGCTCGGGAAAGAGTACTCAAGTACCCCAGTTCCTATACAGAGAGTCATGGTGTCGTCGCATCAAG
ACCCGACTACCAAATTCCCAAGACGAGTTGCACGTTGGTGGAGTCATCGCCATTACCCAGCCACGGCGCGTCGCG
GCAACCAGCTTGGCCTATCGGGTATCTCAAGAAGTCGAAACGCCCCTGGACAAGAGGACGAAAGACGGCTTGGTC
GGTTACGCCGTTCGATTCGACCATCGTGTCCCGCGCGGGACCAAGATCAAGTTTCTCACAGAGGGCACGCTTCTT
CAAGAGCTCCTTCGGGACCCGAACCTGCGCAGTTACAGCGCCATAGTCGTTGACGAGATCCACGAAAGAAGCTTG
AACGTGGATATTCTGATGGGTTTCTTGAAGCAGATCCTGACAGGAGACCTCCGTGGTCGTGGGGGGGTCCCACTG
AAGATTGTCGTCATGAGCGCCACTGCAGACGTGCGCGTTTTCCAGGACTTCCTCAGCGACAATTCCAAGACTGAT
GCAGAAAACCTAGTACGGGTTCTGCAGATTCAGGGCCGACAGTTTCCCGTGGAGATGATACACGAGCCGCAACCG
GTAGCCGACGTGGAAGATGCCCTCCAGCGAAGGATTTTCAAATTACACATGGAAGAACCCCTTCCCGGAGATATC
CTGGCCTTTCTCACGGGCCAGGAGGAGATTGAATCGGCCGAGACGCTCATCGACGAGTTTGCTGCGACATTGGCT
TCTGATGTGCCGAGAATCAAAGTGTGCGCTTTGTACGGGCAGCTGTCCATGGAAAGGCAGCGAGAAGCCTTTTTA
CCCGCCGAGACCTCCTTTACCCGAAAAGTCATACTGGCCACCAACATTGCCGAAACCTCGGTTACGGTCCCCGGC
GTGCGGTACGTGATAGACTGCGGCAAGGCCAAAATCAAGAAGTATCGACCTCGGCTTGGCATGGAATCATTGCTG
CCCAAGGCTATCTCAAAGTCATCGGCTCTACAGCGAGCCGGTAGAGCTGGCCGTGAGGGTCCCGGAAAATGCTTC
AGGCTTTACACAGAAAGCACATTCCAATCATTCCAGGCGGCAGAGCTCCCCGAGATACTTCGCAACGACGTGGTC
GGGGCCGTCCTCACCATGAAGGCGCACGGCATTAGCGACATCTCGGCGTTTCCCTTACTAGACGCACCGGGGACG
AAGTCGACCGAGAGGGCCCTGCTTCAGCTTCACTTCCTCGGCGCGCTCTCCGATGACGGTGTCATCACTCCTGCG
GGCGCCCAGATGGCTAGATTTCCGATCCCCGCTCCCTTCAGCGCGGTGCTCCTCGCGGCCGCCCGTCCCGGATTC
GACTGCGTTACTGAGGTCATCGACATCATCTCGTGCATCGCGTCGGGAGACGACATATTTCTTCGGCTCAAGTCC
GAGGAAGCCCAAGAGCAAGCGGGTCAGCTGCGAAGAGAGCTGCAGAGACGAGAGGGTGACCTCTTGACGTACCTC
ACTACCATGCAGCGTTATACGGCCGAGAACACGGATCGGACTGAGTGGTGTAGGAAGAGGCTAATCAATTTGCGC
AACATGCGACAGGCCTTGAATATTCGGAGGCAACTTCGCAGCCTCTGTGTCAAAGAGGGTCTGTTGGCTCCCCCG
CCTCCGGACCCGCAGCCCTTCTCGCCTGCGAGCCCGGAGAGGGCCGACGTGATCTTGAGGTGCTTCGTGCGAGGC
TTCGCGACCAAGACAGCGATGCTAGCACCAGATGGGAGCTATGTTACCACACAGGGCAAACACGTGGTCGCTATC
CATCCGGCCAGCGTCTTGCACGGGCAGAAAAGGGAGGCTATCATGTTTCTCGAGCACGTGTTTACTAACAAGAGC
TATGCGAAGAAGGTCAGCGCCCTGCGAGCTGACTGGATCGTCGAAGCACTAGAAGAGAGATATTAG
Gene >Ophun1|2272
ATGGCCTCAACTGATACACAGCGGACGCCCAAACGGCTCAAAAGACTCCACGACACCAGTTTCGTGACTCTCGGT
GGCAAAACCATCTCTCTCGAAGGATACTTGGACTCGTCACCCAAGCCGGCCAAGGCTCTCCCTCTCGCTCAGCCT
TTGACGAACTCGATCGCCGATAGCCCAGAGGAGAAGAGAGCCGAGGCGGATCGCTCGAAAGAGAGAAGGCCACAG
AGGTCCAAAGGGAACGGAACCCTCGACGCTCCACAAGATACACGAGATCCTAGGTGGCTGCGAAAGCGCAGAGAG
CTCCCGATATGGCAGCATCGATCGGAAATACAGGCTGCATTGCGCGACCCTGCGAGCAACGCTCTGGTCATCGTC
GGCGAGACAGGCTCGGGAAAGAGTACTCAAGTACCCCAGTTCCTATACAGAGAGTCATGGTGTCGTCGCATCAAG
ACCCGACTACCAAATTCCCAAGACGAGTTGCACGTTGGTGGAGTCATCGCCATTACCCAGCCACGGCGCGTCGCG
GCAACCAGCTTGGCCTATCGGGTATCTCAAGAAGTCGAAACGCCCCTGGACAAGAGGACGAAAGACGGCTTGGTC
GGTTACGCCGTTCGATTCGACCATCGTGTCCCGCGCGGGACCAAGATCAAGTTTCTCACAGAGGGCACGCTTCTT
CAAGAGCTCCTTCGGGACCCGAACCTGCGCAGTTACAGCGCCATAGTCGTTGACGAGATCCACGAAAGAAGCTTG
AACGTGGATATTCTGATGGGTTTCTTGAAGCAGATCCTGACAGGAGACCTCCGTGGTCGTGGGGGGGTCCCACTG
AAGATTGTCGTCATGAGCGCCACTGCAGACGTGCGCGTTTTCCAGGACTTCCTCAGCGACAATTCCAAGACTGAT
GCAGAAAACCTAGTACGGGTTCTGCAGATTCAGGGCCGACAGTTTCCCGTGGAGATGATACACGAGCCGCAACCG
GTAGCCGACGTGGAAGATGCCCTCCAGCGAAGGATTTTCAAATTACACATGGAAGAACCCCTTCCCGGAGATATC
CTGGCCTTTCTCACGGGCCAGGAGGAGATTGAATCGGCCGAGACGCTCATCGACGAGTTTGCTGCGACATTGGCT
TCTGATGTGCCGAGAATCAAAGTGTGCGCTTTGTACGGGCAGCTGTCCATGGAAAGGCAGCGAGAAGCCTTTTTA
CCCGCCGAGACCTCCTTTACCCGAAAAGTCATACTGGCCACCAACATTGCCGAAACCTCGGTTACGGTCCCCGGC
GTGCGGTACGTGATAGACTGCGGCAAGGCCAAAATCAAGAAGTATCGACCTCGGCTTGGCATGGAATCATTGCTG
CCCAAGGCTATCTCAAAGTCATCGGCTCTACAGCGAGCCGGTAGAGCTGGCCGTGAGGGTCCCGGAAAATGCTTC
AGGCTTTACACAGAAAGCACATTCCAATCATTCCAGGCGGCAGAGCTCCCCGAGATACTTCGCAACGACGTGGTC
GGGGCCGTCCTCACCATGAAGGCGCACGGCATTAGCGACATCTCGGCGTTTCCCTTACTAGACGCACCGGGGACG
AAGTCGACCGAGAGGGCCCTGCTTCAGCTTCACTTCCTCGGCGCGCTCTCCGATGACGGTGTCATCACTCCTGCG
GGCGCCCAGATGGCTAGATTTCCGATCCCCGCTCCCTTCAGCGCGGTGCTCCTCGCGGCCGCCCGTCCCGGATTC
GACTGCGTTACTGAGGTCATCGACATCATCTCGTGCATCGCGTCGGGAGACGACATATTTCTTCGGCTCAAGTCC
GAGGAAGCCCAAGAGCAAGCGGGTCAGCTGCGAAGAGAGCTGCAGAGACGAGAGGGTGACCTCTTGACGTACCTC
ACTACCATGCAGCGTTATACGGCCGAGAACACGGATCGGACTGAGTGGTGTAGGAAGAGGCTAATCAATTTGCGC
AACATGCGACAGGCCTTGAATATTCGGAGGCAACTTCGCAGCCTCTGTGTCAAAGAGGGTCTGTTGGCTCCCCCG
CCTCCGGACCCGCAGCCCTTCTCGCCTGCGAGCCCGGAGAGGGCCGACGTGATCTTGAGGTGCTTCGTGCGAGGC
TTCGCGACCAAGACAGCGATGCTAGCACCAGATGGGAGCTATGTTACCACACAGGGCAAACACGTGGTCGCTATC
CATCCGGCCAGCGTCTTGCACGGGCAGAAAAGGGAGGCTATCATGTTTCTCGAGCACGTGTTTACTAACAAGAGC
TATGCGAAGAAGGTCAGCGCCCTGCGAGCTGACTGGATCGTCGAAGCACTAGAAGAGAGATATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail