Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2271
Gene name
LocationContig_21:4952..10892
Strand+
Gene length (bp)5940
Transcript length (bp)5007
Coding sequence length (bp)5007
Protein length (aa) 1669

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00520 Ion_trans Ion transport protein 1.8E-35 22 270
PF00520 Ion_trans Ion transport protein 1.0E-23 306 533
PF00520 Ion_trans Ion transport protein 1.8E-31 737 1016
PF00520 Ion_trans Ion transport protein 3.0E-23 1067 1315
PF13233 Complex1_LYR_2 Complex1_LYR-like 1.8E-11 1551 1650

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14234|CCH1_SCHPO Calcium-channel protein cch1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cch1 PE=3 SV=1 24 1525 0.0E+00
sp|P50077|CCH1_YEAST Calcium-channel protein CCH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCH1 PE=1 SV=1 9 1506 0.0E+00
sp|Q6Q760|NALCN_RAT Sodium leak channel non-selective protein OS=Rattus norvegicus GN=Nalcn PE=1 SV=1 637 1344 2.0E-55
sp|Q8IZF0|NALCN_HUMAN Sodium leak channel non-selective protein OS=Homo sapiens GN=NALCN PE=1 SV=1 637 1344 4.0E-55
sp|Q8BXR5|NALCN_MOUSE Sodium leak channel non-selective protein OS=Mus musculus GN=Nalcn PE=1 SV=2 637 1344 5.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14234|CCH1_SCHPO Calcium-channel protein cch1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cch1 PE=3 SV=1 24 1525 0.0E+00
sp|P50077|CCH1_YEAST Calcium-channel protein CCH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCH1 PE=1 SV=1 9 1506 0.0E+00
sp|Q6Q760|NALCN_RAT Sodium leak channel non-selective protein OS=Rattus norvegicus GN=Nalcn PE=1 SV=1 637 1344 2.0E-55
sp|Q8IZF0|NALCN_HUMAN Sodium leak channel non-selective protein OS=Homo sapiens GN=NALCN PE=1 SV=1 637 1344 4.0E-55
sp|Q8BXR5|NALCN_MOUSE Sodium leak channel non-selective protein OS=Mus musculus GN=Nalcn PE=1 SV=2 637 1344 5.0E-55
sp|P0DMA5|SCNAA_ONYTO Sodium channel protein type 10 subunit alpha OS=Onychomys torridus GN=Scn10a PE=1 SV=1 326 1371 1.0E-41
sp|Q13698|CAC1S_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1S OS=Homo sapiens GN=CACNA1S PE=1 SV=4 24 1344 3.0E-40
sp|Q02789|CAC1S_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1S OS=Mus musculus GN=Cacna1s PE=1 SV=2 24 1344 4.0E-40
sp|P07293|CAC1S_RABIT Voltage-dependent L-type calcium channel subunit alpha-1S OS=Oryctolagus cuniculus GN=CACNA1S PE=1 SV=1 24 1344 2.0E-39
sp|O88457|SCNBA_RAT Sodium channel protein type 11 subunit alpha OS=Rattus norvegicus GN=Scn11a PE=1 SV=1 304 1348 5.0E-39
sp|O46669|SCNAA_CANLF Sodium channel protein type 10 subunit alpha OS=Canis lupus familiaris GN=SCN10A PE=2 SV=1 309 1371 1.0E-38
sp|C9D7C2|CAC1A_APIME Voltage-dependent calcium channel type A subunit alpha-1 OS=Apis mellifera GN=CAC PE=2 SV=1 696 1344 3.0E-36
sp|P91645|CAC1A_DROME Voltage-dependent calcium channel type A subunit alpha-1 OS=Drosophila melanogaster GN=cac PE=1 SV=3 696 1344 1.0E-35
sp|O08562|SCN9A_RAT Sodium channel protein type 9 subunit alpha OS=Rattus norvegicus GN=Scn9a PE=1 SV=1 776 1344 1.0E-35
sp|Q15858|SCN9A_HUMAN Sodium channel protein type 9 subunit alpha OS=Homo sapiens GN=SCN9A PE=1 SV=3 742 1344 3.0E-35
sp|P22316|CAC1S_CYPCA Dihydropyridine-sensitive L-type skeletal muscle calcium channel subunit alpha-1 OS=Cyprinus carpio PE=2 SV=1 332 1344 4.0E-35
sp|Q25452|CAC1M_MUSDO Muscle calcium channel subunit alpha-1 OS=Musca domestica PE=2 SV=1 693 1357 5.0E-35
sp|O57483|CAC1S_LITCT Voltage-dependent L-type calcium channel subunit alpha-1S OS=Lithobates catesbeiana PE=2 SV=1 696 1344 6.0E-35
sp|Q6QIY3|SCNAA_MOUSE Sodium channel protein type 10 subunit alpha OS=Mus musculus GN=Scn10a PE=1 SV=2 737 1371 9.0E-35
sp|Q9W0Y8|SCN60_DROME Sodium channel protein 60E OS=Drosophila melanogaster GN=NaCP60E PE=2 SV=5 776 1344 1.0E-34
sp|Q62205|SCN9A_MOUSE Sodium channel protein type 9 subunit alpha OS=Mus musculus GN=Scn9a PE=1 SV=2 776 1344 1.0E-34
sp|Q28644|SCN9A_RABIT Sodium channel protein type 9 subunit alpha OS=Oryctolagus cuniculus GN=SCN9A PE=2 SV=1 776 1344 1.0E-34
sp|P35500|SCNA_DROME Sodium channel protein para OS=Drosophila melanogaster GN=para PE=2 SV=3 744 1368 1.0E-34
sp|P56699|CAC1E_DIPOM Probable voltage-dependent R-type calcium channel subunit alpha-1E OS=Diplobatis ommata PE=2 SV=1 641 1344 4.0E-34
sp|P04774|SCN1A_RAT Sodium channel protein type 1 subunit alpha OS=Rattus norvegicus GN=Scn1a PE=1 SV=1 776 1375 4.0E-34
sp|P08104|SCN3A_RAT Sodium channel protein type 3 subunit alpha OS=Rattus norvegicus GN=Scn3a PE=1 SV=1 776 1344 6.0E-34
sp|P35498|SCN1A_HUMAN Sodium channel protein type 1 subunit alpha OS=Homo sapiens GN=SCN1A PE=1 SV=2 776 1375 2.0E-33
sp|P15381|CAC1C_RABIT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Oryctolagus cuniculus GN=CACNA1C PE=1 SV=1 696 1344 3.0E-33
sp|Q00975|CAC1B_HUMAN Voltage-dependent N-type calcium channel subunit alpha-1B OS=Homo sapiens GN=CACNA1B PE=1 SV=1 696 1357 4.0E-33
sp|Q9JJV9|SCN5A_MOUSE Sodium channel protein type 5 subunit alpha OS=Mus musculus GN=Scn5a PE=1 SV=2 776 1368 6.0E-33
sp|P15389|SCN5A_RAT Sodium channel protein type 5 subunit alpha OS=Rattus norvegicus GN=Scn5a PE=1 SV=1 776 1368 8.0E-33
sp|Q05973|SCN1_HETBL Sodium channel protein 1 brain OS=Heterololigo bleekeri PE=2 SV=1 745 1369 1.0E-32
sp|O88420|SCN8A_RAT Sodium channel protein type 8 subunit alpha OS=Rattus norvegicus GN=Scn8a PE=1 SV=1 776 1344 1.0E-32
sp|Q14524|SCN5A_HUMAN Sodium channel protein type 5 subunit alpha OS=Homo sapiens GN=SCN5A PE=1 SV=2 776 1368 1.0E-32
sp|Q9NY46|SCN3A_HUMAN Sodium channel protein type 3 subunit alpha OS=Homo sapiens GN=SCN3A PE=1 SV=2 776 1344 1.0E-32
sp|Q2XVR6|SC4AB_TAKRU Sodium channel protein type 4 subunit alpha B OS=Takifugu rubripes GN=scn4ab PE=3 SV=1 723 1344 2.0E-32
sp|Q9WTU3|SCN8A_MOUSE Sodium channel protein type 8 subunit alpha OS=Mus musculus GN=Scn8a PE=1 SV=1 776 1344 2.0E-32
sp|Q99250|SCN2A_HUMAN Sodium channel protein type 2 subunit alpha OS=Homo sapiens GN=SCN2A PE=1 SV=3 776 1344 2.0E-32
sp|Q2XVR5|SC4AA_TETNG Sodium channel protein type 4 subunit alpha A OS=Tetraodon nigroviridis GN=scn4aa PE=3 SV=2 776 1344 2.0E-32
sp|Q01815|CAC1C_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1C OS=Mus musculus GN=Cacna1c PE=1 SV=1 696 1344 2.0E-32
sp|P04775|SCN2A_RAT Sodium channel protein type 2 subunit alpha OS=Rattus norvegicus GN=Scn2a PE=1 SV=1 776 1344 5.0E-32
sp|Q9UQD0|SCN8A_HUMAN Sodium channel protein type 8 subunit alpha OS=Homo sapiens GN=SCN8A PE=1 SV=1 776 1344 5.0E-32
sp|Q05152|CAC1B_RABIT Voltage-dependent N-type calcium channel subunit alpha-1B OS=Oryctolagus cuniculus GN=CACNA1B PE=1 SV=1 696 1357 1.0E-31
sp|O55017|CAC1B_MOUSE Voltage-dependent N-type calcium channel subunit alpha-1B OS=Mus musculus GN=Cacna1b PE=1 SV=1 696 1357 2.0E-31
sp|P27732|CAC1D_RAT Voltage-dependent L-type calcium channel subunit alpha-1D OS=Rattus norvegicus GN=Cacna1d PE=1 SV=2 684 1344 2.0E-31
sp|Q9Y5Y9|SCNAA_HUMAN Sodium channel protein type 10 subunit alpha OS=Homo sapiens GN=SCN10A PE=1 SV=2 737 1371 2.0E-31
sp|P56698|CAC1B_DIPOM Probable voltage-dependent N-type calcium channel subunit alpha-1B OS=Diplobatis ommata PE=2 SV=1 691 1345 2.0E-31
sp|Q13936|CAC1C_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1C OS=Homo sapiens GN=CACNA1C PE=1 SV=4 458 1344 4.0E-31
sp|Q7SF55|SDHF3_NEUCR Succinate dehydrogenase assembly factor 3, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-17 PE=3 SV=1 1549 1664 5.0E-31
sp|Q02294|CAC1B_RAT Voltage-dependent N-type calcium channel subunit alpha-1B OS=Rattus norvegicus GN=Cacna1b PE=1 SV=1 696 1357 7.0E-31
sp|P22002|CAC1C_RAT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Rattus norvegicus GN=Cacna1c PE=1 SV=1 696 1344 9.0E-31
sp|Q4IN52|SDHF3_GIBZE Succinate dehydrogenase assembly factor 3, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGSG_01356 PE=3 SV=1 1549 1664 1.0E-30
sp|O73700|CAC1D_CHICK Voltage-dependent L-type calcium channel subunit alpha-1D OS=Gallus gallus GN=CACNA1D PE=2 SV=1 696 1344 2.0E-30
sp|P15390|SCN4A_RAT Sodium channel protein type 4 subunit alpha OS=Rattus norvegicus GN=Scn4a PE=1 SV=1 776 1344 3.0E-30
sp|Q9R053|SCNBA_MOUSE Sodium channel protein type 11 subunit alpha OS=Mus musculus GN=Scn11a PE=2 SV=2 777 1344 3.0E-30
sp|Q2XVR7|SC4AA_TAKRU Sodium channel protein type 4 subunit alpha A OS=Takifugu rubripes GN=scn4aa PE=3 SV=1 763 1344 3.0E-30
sp|Q62968|SCNAA_RAT Sodium channel protein type 10 subunit alpha OS=Rattus norvegicus GN=Scn10a PE=1 SV=1 737 1371 6.0E-30
sp|Q9EQ60|CAC1H_RAT Voltage-dependent T-type calcium channel subunit alpha-1H OS=Rattus norvegicus GN=Cacna1h PE=2 SV=2 689 1255 7.0E-30
sp|Q9ER60|SCN4A_MOUSE Sodium channel protein type 4 subunit alpha OS=Mus musculus GN=Scn4a PE=2 SV=1 776 1344 8.0E-30
sp|Q20JQ7|SC4AB_DANRE Sodium channel protein type 4 subunit alpha B OS=Danio rerio GN=scn4ab PE=2 SV=1 776 1378 1.0E-29
sp|Q01668|CAC1D_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1D OS=Homo sapiens GN=CACNA1D PE=1 SV=2 684 1344 2.0E-29
sp|Q25452|CAC1M_MUSDO Muscle calcium channel subunit alpha-1 OS=Musca domestica PE=2 SV=1 659 1255 3.0E-29
sp|Q99246|CAC1D_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1D OS=Mus musculus GN=Cacna1d PE=1 SV=3 684 1344 4.0E-29
sp|Q2XVR4|SC4AB_TETNG Sodium channel protein type 4 subunit alpha B OS=Tetraodon nigroviridis GN=scn4ab PE=3 SV=1 734 1344 4.0E-29
sp|O88427|CAC1H_MOUSE Voltage-dependent T-type calcium channel subunit alpha-1H OS=Mus musculus GN=Cacna1h PE=1 SV=3 689 1255 4.0E-29
sp|Q9JIS7|CAC1F_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1F OS=Mus musculus GN=Cacna1f PE=1 SV=1 696 1344 4.0E-29
sp|Q02343|CAC1E_RABIT Voltage-dependent R-type calcium channel subunit alpha-1E OS=Oryctolagus cuniculus GN=CACNA1E PE=2 SV=1 655 1344 1.0E-28
sp|Q13698|CAC1S_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1S OS=Homo sapiens GN=CACNA1S PE=1 SV=4 679 1328 2.0E-28
sp|Q99244|CAC1D_MESAU Voltage-dependent L-type calcium channel subunit alpha-1D OS=Mesocricetus auratus GN=CACNA1D PE=2 SV=2 696 1344 2.0E-28
sp|Q24270|CAC1D_DROME Voltage-dependent calcium channel type D subunit alpha-1 OS=Drosophila melanogaster GN=Ca-alpha1D PE=1 SV=2 778 1357 2.0E-28
sp|Q24270|CAC1D_DROME Voltage-dependent calcium channel type D subunit alpha-1 OS=Drosophila melanogaster GN=Ca-alpha1D PE=1 SV=2 681 1325 2.0E-28
sp|Q9UI33|SCNBA_HUMAN Sodium channel protein type 11 subunit alpha OS=Homo sapiens GN=SCN11A PE=1 SV=2 724 1348 5.0E-28
sp|P35499|SCN4A_HUMAN Sodium channel protein type 4 subunit alpha OS=Homo sapiens GN=SCN4A PE=1 SV=4 776 1352 5.0E-28
sp|Q15878|CAC1E_HUMAN Voltage-dependent R-type calcium channel subunit alpha-1E OS=Homo sapiens GN=CACNA1E PE=1 SV=3 694 1344 7.0E-28
sp|P97445|CAC1A_MOUSE Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Mus musculus GN=Cacna1a PE=1 SV=2 691 1344 9.0E-28
sp|Q07652|CAC1E_RAT Voltage-dependent R-type calcium channel subunit alpha-1E OS=Rattus norvegicus GN=Cacna1e PE=1 SV=1 694 1344 9.0E-28
sp|P0C146|SDHF3_MAGO7 Succinate dehydrogenase assembly factor 3, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_17437 PE=3 SV=2 1552 1664 1.0E-27
sp|Q61290|CAC1E_MOUSE Voltage-dependent R-type calcium channel subunit alpha-1E OS=Mus musculus GN=Cacna1e PE=1 SV=1 694 1344 1.0E-27
sp|P27884|CAC1A_RABIT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Oryctolagus cuniculus GN=CACNA1A PE=1 SV=1 600 1342 1.0E-27
sp|Q9P0X4|CAC1I_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1I OS=Homo sapiens GN=CACNA1I PE=1 SV=1 689 1324 2.0E-27
sp|O60840|CAC1F_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1F OS=Homo sapiens GN=CACNA1F PE=1 SV=2 696 1344 2.0E-27
sp|O54898|CAC1G_RAT Voltage-dependent T-type calcium channel subunit alpha-1G OS=Rattus norvegicus GN=Cacna1g PE=1 SV=2 688 1306 2.0E-27
sp|P54282|CAC1A_RAT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Rattus norvegicus GN=Cacna1a PE=1 SV=1 691 1344 3.0E-27
sp|Q02485|CAC1S_RAT Voltage-dependent L-type calcium channel subunit alpha-1S (Fragment) OS=Rattus norvegicus GN=Cacna1s PE=1 SV=1 696 1344 6.0E-27
sp|Q02789|CAC1S_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1S OS=Mus musculus GN=Cacna1s PE=1 SV=2 679 1253 9.0E-27
sp|Q13936|CAC1C_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1C OS=Homo sapiens GN=CACNA1C PE=1 SV=4 673 1255 2.0E-26
sp|Q9Z0Y8|CAC1I_RAT Voltage-dependent T-type calcium channel subunit alpha-1I OS=Rattus norvegicus GN=Cacna1i PE=1 SV=3 689 1324 2.0E-26
sp|Q2XVR3|SC4AA_DANRE Sodium channel protein type 4 subunit alpha A OS=Danio rerio GN=scn4aa PE=2 SV=2 776 1344 2.0E-26
sp|O95180|CAC1H_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1H OS=Homo sapiens GN=CACNA1H PE=1 SV=4 689 1255 2.0E-26
sp|P07293|CAC1S_RABIT Voltage-dependent L-type calcium channel subunit alpha-1S OS=Oryctolagus cuniculus GN=CACNA1S PE=1 SV=1 679 1328 4.0E-26
sp|O00555|CAC1A_HUMAN Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Homo sapiens GN=CACNA1A PE=1 SV=2 691 1342 4.0E-26
sp|P02719|SCNA_ELEEL Sodium channel protein OS=Electrophorus electricus PE=2 SV=1 734 1368 8.0E-26
sp|Q5BBH7|SDHF3_EMENI Succinate dehydrogenase assembly factor 3, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN2103 PE=3 SV=1 1549 1665 1.0E-25
sp|P15381|CAC1C_RABIT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Oryctolagus cuniculus GN=CACNA1C PE=1 SV=1 673 1255 2.0E-25
sp|Q4WHK3|SDHF3_ASPFU Succinate dehydrogenase assembly factor 3, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G05090 PE=3 SV=1 1552 1666 4.0E-25
sp|Q28371|SCN4A_HORSE Sodium channel protein type 4 subunit alpha OS=Equus caballus GN=SCN4A PE=1 SV=1 776 1344 7.0E-25
sp|O57483|CAC1S_LITCT Voltage-dependent L-type calcium channel subunit alpha-1S OS=Lithobates catesbeiana PE=2 SV=1 696 1253 5.0E-23
sp|Q01118|SCN7A_HUMAN Sodium channel protein type 7 subunit alpha OS=Homo sapiens GN=SCN7A PE=1 SV=2 304 1344 3.0E-21
sp|Q25452|CAC1M_MUSDO Muscle calcium channel subunit alpha-1 OS=Musca domestica PE=2 SV=1 24 565 5.0E-21
sp|Q01815|CAC1C_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1C OS=Mus musculus GN=Cacna1c PE=1 SV=1 673 1015 3.0E-20
sp|P22002|CAC1C_RAT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Rattus norvegicus GN=Cacna1c PE=1 SV=1 673 1015 4.0E-20
sp|Q59L89|SDHF3_CANAL Succinate dehydrogenase assembly factor 3, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SDH7 PE=3 SV=1 1551 1663 4.0E-20
sp|Q24270|CAC1D_DROME Voltage-dependent calcium channel type D subunit alpha-1 OS=Drosophila melanogaster GN=Ca-alpha1D PE=1 SV=2 20 556 6.0E-20
sp|P02719|SCNA_ELEEL Sodium channel protein OS=Electrophorus electricus PE=2 SV=1 33 536 8.0E-20
sp|O43497|CAC1G_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1G OS=Homo sapiens GN=CACNA1G PE=2 SV=3 688 1012 1.0E-18
sp|O73700|CAC1D_CHICK Voltage-dependent L-type calcium channel subunit alpha-1D OS=Gallus gallus GN=CACNA1D PE=2 SV=1 671 1015 3.0E-18
sp|Q99246|CAC1D_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1D OS=Mus musculus GN=Cacna1d PE=1 SV=3 681 1015 5.0E-18
sp|P35500|SCNA_DROME Sodium channel protein para OS=Drosophila melanogaster GN=para PE=2 SV=3 18 536 7.0E-18
sp|P22316|CAC1S_CYPCA Dihydropyridine-sensitive L-type skeletal muscle calcium channel subunit alpha-1 OS=Cyprinus carpio PE=2 SV=1 680 1253 8.0E-18
sp|Q01668|CAC1D_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1D OS=Homo sapiens GN=CACNA1D PE=1 SV=2 681 1015 1.0E-17
sp|Q9P7Y2|SDHF3_SCHPO Succinate dehydrogenase assembly factor 3, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP23A10.03c PE=3 SV=1 1551 1667 1.0E-17
sp|Q2XVR5|SC4AA_TETNG Sodium channel protein type 4 subunit alpha A OS=Tetraodon nigroviridis GN=scn4aa PE=3 SV=2 23 536 2.0E-17
sp|P27732|CAC1D_RAT Voltage-dependent L-type calcium channel subunit alpha-1D OS=Rattus norvegicus GN=Cacna1d PE=1 SV=2 681 1015 2.0E-17
sp|Q99244|CAC1D_MESAU Voltage-dependent L-type calcium channel subunit alpha-1D OS=Mesocricetus auratus GN=CACNA1D PE=2 SV=2 669 1015 2.0E-17
sp|Q751X1|SDHF3_ASHGO Succinate dehydrogenase assembly factor 3, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AFR704W PE=3 SV=1 1551 1668 2.0E-17
sp|O57483|CAC1S_LITCT Voltage-dependent L-type calcium channel subunit alpha-1S OS=Lithobates catesbeiana PE=2 SV=1 20 572 3.0E-17
sp|Q6BIY6|SDHF3_DEBHA Succinate dehydrogenase assembly factor 3, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G06622g PE=3 SV=1 1551 1667 3.0E-17
sp|Q9R053|SCNBA_MOUSE Sodium channel protein type 11 subunit alpha OS=Mus musculus GN=Scn11a PE=2 SV=2 42 536 6.0E-17
sp|Q9W0Y8|SCN60_DROME Sodium channel protein 60E OS=Drosophila melanogaster GN=NaCP60E PE=2 SV=5 33 539 1.0E-16
sp|O60840|CAC1F_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1F OS=Homo sapiens GN=CACNA1F PE=1 SV=2 639 1015 2.0E-16
sp|Q9WTU3|SCN8A_MOUSE Sodium channel protein type 8 subunit alpha OS=Mus musculus GN=Scn8a PE=1 SV=1 25 536 3.0E-16
sp|Q9UQD0|SCN8A_HUMAN Sodium channel protein type 8 subunit alpha OS=Homo sapiens GN=SCN8A PE=1 SV=1 25 536 5.0E-16
sp|Q2XVR7|SC4AA_TAKRU Sodium channel protein type 4 subunit alpha A OS=Takifugu rubripes GN=scn4aa PE=3 SV=1 23 536 5.0E-16
sp|O88457|SCNBA_RAT Sodium channel protein type 11 subunit alpha OS=Rattus norvegicus GN=Scn11a PE=1 SV=1 33 536 6.0E-16
sp|O88420|SCN8A_RAT Sodium channel protein type 8 subunit alpha OS=Rattus norvegicus GN=Scn8a PE=1 SV=1 25 536 8.0E-16
sp|P0DMA5|SCNAA_ONYTO Sodium channel protein type 10 subunit alpha OS=Onychomys torridus GN=Scn10a PE=1 SV=1 61 536 9.0E-16
sp|Q9JIS7|CAC1F_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1F OS=Mus musculus GN=Cacna1f PE=1 SV=1 647 1015 1.0E-15
sp|Q20JQ7|SC4AB_DANRE Sodium channel protein type 4 subunit alpha B OS=Danio rerio GN=scn4ab PE=2 SV=1 23 536 2.0E-15
sp|Q4PCI7|SDHF3_USTMA Succinate dehydrogenase assembly factor 3, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10065 PE=3 SV=2 1549 1663 3.0E-15
sp|Q6FMR7|SDHF3_CANGA Succinate dehydrogenase assembly factor 3, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0K05775g PE=3 SV=1 1549 1663 3.0E-15
sp|Q6QIY3|SCNAA_MOUSE Sodium channel protein type 10 subunit alpha OS=Mus musculus GN=Scn10a PE=1 SV=2 58 536 4.0E-15
sp|Q05973|SCN1_HETBL Sodium channel protein 1 brain OS=Heterololigo bleekeri PE=2 SV=1 22 489 4.0E-15
sp|Q05973|SCN1_HETBL Sodium channel protein 1 brain OS=Heterololigo bleekeri PE=2 SV=1 696 1264 4.0E-15
sp|Q04401|SDHF3_YEAST Succinate dehydrogenase assembly factor 3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH7 PE=1 SV=1 1541 1663 5.0E-15
sp|Q8IZF0|NALCN_HUMAN Sodium leak channel non-selective protein OS=Homo sapiens GN=NALCN PE=1 SV=1 107 543 6.0E-15
sp|Q8BXR5|NALCN_MOUSE Sodium leak channel non-selective protein OS=Mus musculus GN=Nalcn PE=1 SV=2 107 543 8.0E-15
sp|P08104|SCN3A_RAT Sodium channel protein type 3 subunit alpha OS=Rattus norvegicus GN=Scn3a PE=1 SV=1 33 536 9.0E-15
sp|Q6Q760|NALCN_RAT Sodium leak channel non-selective protein OS=Rattus norvegicus GN=Nalcn PE=1 SV=1 107 543 1.0E-14
sp|P04774|SCN1A_RAT Sodium channel protein type 1 subunit alpha OS=Rattus norvegicus GN=Scn1a PE=1 SV=1 33 536 1.0E-14
sp|P35498|SCN1A_HUMAN Sodium channel protein type 1 subunit alpha OS=Homo sapiens GN=SCN1A PE=1 SV=2 33 536 1.0E-14
sp|Q99250|SCN2A_HUMAN Sodium channel protein type 2 subunit alpha OS=Homo sapiens GN=SCN2A PE=1 SV=3 33 536 2.0E-14
sp|Q2XVR4|SC4AB_TETNG Sodium channel protein type 4 subunit alpha B OS=Tetraodon nigroviridis GN=scn4ab PE=3 SV=1 23 536 2.0E-14
sp|Q6CUY0|SDHF3_KLULA Succinate dehydrogenase assembly factor 3, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0C01430g PE=3 SV=1 1551 1666 2.0E-14
sp|P15390|SCN4A_RAT Sodium channel protein type 4 subunit alpha OS=Rattus norvegicus GN=Scn4a PE=1 SV=1 23 536 4.0E-14
sp|Q61290|CAC1E_MOUSE Voltage-dependent R-type calcium channel subunit alpha-1E OS=Mus musculus GN=Cacna1e PE=1 SV=1 694 1033 5.0E-14
sp|Q2XVR6|SC4AB_TAKRU Sodium channel protein type 4 subunit alpha B OS=Takifugu rubripes GN=scn4ab PE=3 SV=1 23 536 7.0E-14
sp|P04775|SCN2A_RAT Sodium channel protein type 2 subunit alpha OS=Rattus norvegicus GN=Scn2a PE=1 SV=1 33 536 8.0E-14
sp|Q00975|CAC1B_HUMAN Voltage-dependent N-type calcium channel subunit alpha-1B OS=Homo sapiens GN=CACNA1B PE=1 SV=1 694 1033 1.0E-13
sp|Q9ER60|SCN4A_MOUSE Sodium channel protein type 4 subunit alpha OS=Mus musculus GN=Scn4a PE=2 SV=1 23 536 1.0E-13
sp|Q02343|CAC1E_RABIT Voltage-dependent R-type calcium channel subunit alpha-1E OS=Oryctolagus cuniculus GN=CACNA1E PE=2 SV=1 694 1033 2.0E-13
sp|Q15878|CAC1E_HUMAN Voltage-dependent R-type calcium channel subunit alpha-1E OS=Homo sapiens GN=CACNA1E PE=1 SV=3 694 1033 2.0E-13
sp|Q07652|CAC1E_RAT Voltage-dependent R-type calcium channel subunit alpha-1E OS=Rattus norvegicus GN=Cacna1e PE=1 SV=1 694 1033 2.0E-13
sp|Q9NY46|SCN3A_HUMAN Sodium channel protein type 3 subunit alpha OS=Homo sapiens GN=SCN3A PE=1 SV=2 33 536 3.0E-13
sp|O55017|CAC1B_MOUSE Voltage-dependent N-type calcium channel subunit alpha-1B OS=Mus musculus GN=Cacna1b PE=1 SV=1 694 1033 4.0E-13
sp|P56699|CAC1E_DIPOM Probable voltage-dependent R-type calcium channel subunit alpha-1E OS=Diplobatis ommata PE=2 SV=1 694 1033 5.0E-13
sp|P56698|CAC1B_DIPOM Probable voltage-dependent N-type calcium channel subunit alpha-1B OS=Diplobatis ommata PE=2 SV=1 694 1033 6.0E-13
sp|Q05152|CAC1B_RABIT Voltage-dependent N-type calcium channel subunit alpha-1B OS=Oryctolagus cuniculus GN=CACNA1B PE=1 SV=1 694 1033 7.0E-13
sp|Q2XVR6|SC4AB_TAKRU Sodium channel protein type 4 subunit alpha B OS=Takifugu rubripes GN=scn4ab PE=3 SV=1 20 490 9.0E-13
sp|Q15858|SCN9A_HUMAN Sodium channel protein type 9 subunit alpha OS=Homo sapiens GN=SCN9A PE=1 SV=3 23 536 1.0E-12
sp|Q02294|CAC1B_RAT Voltage-dependent N-type calcium channel subunit alpha-1B OS=Rattus norvegicus GN=Cacna1b PE=1 SV=1 694 1033 1.0E-12
sp|O08562|SCN9A_RAT Sodium channel protein type 9 subunit alpha OS=Rattus norvegicus GN=Scn9a PE=1 SV=1 23 536 2.0E-12
sp|Q14524|SCN5A_HUMAN Sodium channel protein type 5 subunit alpha OS=Homo sapiens GN=SCN5A PE=1 SV=2 23 536 2.0E-12
sp|P35499|SCN4A_HUMAN Sodium channel protein type 4 subunit alpha OS=Homo sapiens GN=SCN4A PE=1 SV=4 23 536 2.0E-12
sp|P56699|CAC1E_DIPOM Probable voltage-dependent R-type calcium channel subunit alpha-1E OS=Diplobatis ommata PE=2 SV=1 22 268 3.0E-12
sp|Q2XVR3|SC4AA_DANRE Sodium channel protein type 4 subunit alpha A OS=Danio rerio GN=scn4aa PE=2 SV=2 23 536 3.0E-12
sp|Q9NY46|SCN3A_HUMAN Sodium channel protein type 3 subunit alpha OS=Homo sapiens GN=SCN3A PE=1 SV=2 24 264 6.0E-12
sp|Q2XVR4|SC4AB_TETNG Sodium channel protein type 4 subunit alpha B OS=Tetraodon nigroviridis GN=scn4ab PE=3 SV=1 24 490 7.0E-12
sp|Q15878|CAC1E_HUMAN Voltage-dependent R-type calcium channel subunit alpha-1E OS=Homo sapiens GN=CACNA1E PE=1 SV=3 22 268 8.0E-12
sp|Q9UI33|SCNBA_HUMAN Sodium channel protein type 11 subunit alpha OS=Homo sapiens GN=SCN11A PE=1 SV=2 659 1037 9.0E-12
sp|Q07652|CAC1E_RAT Voltage-dependent R-type calcium channel subunit alpha-1E OS=Rattus norvegicus GN=Cacna1e PE=1 SV=1 22 268 9.0E-12
sp|Q61290|CAC1E_MOUSE Voltage-dependent R-type calcium channel subunit alpha-1E OS=Mus musculus GN=Cacna1e PE=1 SV=1 22 268 9.0E-12
sp|Q9Y5Y9|SCNAA_HUMAN Sodium channel protein type 10 subunit alpha OS=Homo sapiens GN=SCN10A PE=1 SV=2 23 536 1.0E-11
sp|Q02343|CAC1E_RABIT Voltage-dependent R-type calcium channel subunit alpha-1E OS=Oryctolagus cuniculus GN=CACNA1E PE=2 SV=1 22 268 1.0E-11
sp|P08104|SCN3A_RAT Sodium channel protein type 3 subunit alpha OS=Rattus norvegicus GN=Scn3a PE=1 SV=1 24 264 2.0E-11
sp|O54898|CAC1G_RAT Voltage-dependent T-type calcium channel subunit alpha-1G OS=Rattus norvegicus GN=Cacna1g PE=1 SV=2 1049 1314 3.0E-11
sp|O43497|CAC1G_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1G OS=Homo sapiens GN=CACNA1G PE=2 SV=3 1049 1314 3.0E-11
sp|O46669|SCNAA_CANLF Sodium channel protein type 10 subunit alpha OS=Canis lupus familiaris GN=SCN10A PE=2 SV=1 24 327 4.0E-11
sp|Q9UI33|SCNBA_HUMAN Sodium channel protein type 11 subunit alpha OS=Homo sapiens GN=SCN11A PE=1 SV=2 322 536 4.0E-11
sp|P54282|CAC1A_RAT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Rattus norvegicus GN=Cacna1a PE=1 SV=1 694 1033 5.0E-11
sp|P97445|CAC1A_MOUSE Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Mus musculus GN=Cacna1a PE=1 SV=2 694 1033 7.0E-11
sp|P91645|CAC1A_DROME Voltage-dependent calcium channel type A subunit alpha-1 OS=Drosophila melanogaster GN=cac PE=1 SV=3 18 263 8.0E-11
sp|Q9Y5Y9|SCNAA_HUMAN Sodium channel protein type 10 subunit alpha OS=Homo sapiens GN=SCN10A PE=1 SV=2 24 264 8.0E-11
sp|Q2XVR4|SC4AB_TETNG Sodium channel protein type 4 subunit alpha B OS=Tetraodon nigroviridis GN=scn4ab PE=3 SV=1 659 1259 9.0E-11
sp|P27884|CAC1A_RABIT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Oryctolagus cuniculus GN=CACNA1A PE=1 SV=1 694 1033 9.0E-11
sp|O00555|CAC1A_HUMAN Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Homo sapiens GN=CACNA1A PE=1 SV=2 694 1033 1.0E-10
sp|Q15858|SCN9A_HUMAN Sodium channel protein type 9 subunit alpha OS=Homo sapiens GN=SCN9A PE=1 SV=3 692 1035 2.0E-10
sp|Q62968|SCNAA_RAT Sodium channel protein type 10 subunit alpha OS=Rattus norvegicus GN=Scn10a PE=1 SV=1 24 273 2.0E-10
sp|P0DMA5|SCNAA_ONYTO Sodium channel protein type 10 subunit alpha OS=Onychomys torridus GN=Scn10a PE=1 SV=1 24 264 3.0E-10
sp|C9D7C2|CAC1A_APIME Voltage-dependent calcium channel type A subunit alpha-1 OS=Apis mellifera GN=CAC PE=2 SV=1 731 1033 3.0E-10
sp|O57483|CAC1S_LITCT Voltage-dependent L-type calcium channel subunit alpha-1S OS=Lithobates catesbeiana PE=2 SV=1 20 531 4.0E-10
sp|Q62205|SCN9A_MOUSE Sodium channel protein type 9 subunit alpha OS=Mus musculus GN=Scn9a PE=1 SV=2 692 1038 5.0E-10
sp|P04775|SCN2A_RAT Sodium channel protein type 2 subunit alpha OS=Rattus norvegicus GN=Scn2a PE=1 SV=1 24 264 5.0E-10
sp|P35500|SCNA_DROME Sodium channel protein para OS=Drosophila melanogaster GN=para PE=2 SV=3 696 1014 6.0E-10
sp|P35498|SCN1A_HUMAN Sodium channel protein type 1 subunit alpha OS=Homo sapiens GN=SCN1A PE=1 SV=2 24 264 7.0E-10
sp|P04774|SCN1A_RAT Sodium channel protein type 1 subunit alpha OS=Rattus norvegicus GN=Scn1a PE=1 SV=1 24 264 8.0E-10
sp|O08562|SCN9A_RAT Sodium channel protein type 9 subunit alpha OS=Rattus norvegicus GN=Scn9a PE=1 SV=1 692 1038 9.0E-10
sp|Q28644|SCN9A_RABIT Sodium channel protein type 9 subunit alpha OS=Oryctolagus cuniculus GN=SCN9A PE=2 SV=1 692 1038 9.0E-10
sp|Q6QIY3|SCNAA_MOUSE Sodium channel protein type 10 subunit alpha OS=Mus musculus GN=Scn10a PE=1 SV=2 25 273 2.0E-09
sp|Q99250|SCN2A_HUMAN Sodium channel protein type 2 subunit alpha OS=Homo sapiens GN=SCN2A PE=1 SV=3 24 264 2.0E-09
sp|Q20JQ7|SC4AB_DANRE Sodium channel protein type 4 subunit alpha B OS=Danio rerio GN=scn4ab PE=2 SV=1 24 263 2.0E-09
sp|P02719|SCNA_ELEEL Sodium channel protein OS=Electrophorus electricus PE=2 SV=1 24 264 2.0E-09
sp|Q9UQD0|SCN8A_HUMAN Sodium channel protein type 8 subunit alpha OS=Homo sapiens GN=SCN8A PE=1 SV=1 735 1038 3.0E-09
sp|C9D7C2|CAC1A_APIME Voltage-dependent calcium channel type A subunit alpha-1 OS=Apis mellifera GN=CAC PE=2 SV=1 24 531 5.0E-09
sp|P0CM00|SDHF3_CRYNJ Succinate dehydrogenase assembly factor 3, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNB04080 PE=3 SV=1 1564 1662 7.0E-09
sp|P0CM01|SDHF3_CRYNB Succinate dehydrogenase assembly factor 3, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBB1660 PE=3 SV=1 1564 1662 7.0E-09
sp|Q2XVR5|SC4AA_TETNG Sodium channel protein type 4 subunit alpha A OS=Tetraodon nigroviridis GN=scn4aa PE=3 SV=2 772 1027 8.0E-09
sp|O46669|SCNAA_CANLF Sodium channel protein type 10 subunit alpha OS=Canis lupus familiaris GN=SCN10A PE=2 SV=1 778 1036 1.0E-08
sp|Q6QIY3|SCNAA_MOUSE Sodium channel protein type 10 subunit alpha OS=Mus musculus GN=Scn10a PE=1 SV=2 778 1036 1.0E-08
sp|Q28644|SCN9A_RABIT Sodium channel protein type 9 subunit alpha OS=Oryctolagus cuniculus GN=SCN9A PE=2 SV=1 360 536 1.0E-08
sp|Q9Y5Y9|SCNAA_HUMAN Sodium channel protein type 10 subunit alpha OS=Homo sapiens GN=SCN10A PE=1 SV=2 778 1036 1.0E-08
sp|Q28371|SCN4A_HORSE Sodium channel protein type 4 subunit alpha OS=Equus caballus GN=SCN4A PE=1 SV=1 309 536 1.0E-08
sp|O43497|CAC1G_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1G OS=Homo sapiens GN=CACNA1G PE=2 SV=3 393 647 1.0E-08
sp|O08562|SCN9A_RAT Sodium channel protein type 9 subunit alpha OS=Rattus norvegicus GN=Scn9a PE=1 SV=1 24 264 2.0E-08
sp|P35500|SCNA_DROME Sodium channel protein para OS=Drosophila melanogaster GN=para PE=2 SV=3 24 267 2.0E-08
sp|P04774|SCN1A_RAT Sodium channel protein type 1 subunit alpha OS=Rattus norvegicus GN=Scn1a PE=1 SV=1 659 1038 2.0E-08
sp|P08104|SCN3A_RAT Sodium channel protein type 3 subunit alpha OS=Rattus norvegicus GN=Scn3a PE=1 SV=1 644 1038 2.0E-08
sp|P27732|CAC1D_RAT Voltage-dependent L-type calcium channel subunit alpha-1D OS=Rattus norvegicus GN=Cacna1d PE=1 SV=2 20 531 2.0E-08
sp|P22002|CAC1C_RAT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Rattus norvegicus GN=Cacna1c PE=1 SV=1 20 531 2.0E-08
sp|Q62968|SCNAA_RAT Sodium channel protein type 10 subunit alpha OS=Rattus norvegicus GN=Scn10a PE=1 SV=1 778 1036 2.0E-08
sp|Q2XVR3|SC4AA_DANRE Sodium channel protein type 4 subunit alpha A OS=Danio rerio GN=scn4aa PE=2 SV=2 24 274 2.0E-08
sp|Q62205|SCN9A_MOUSE Sodium channel protein type 9 subunit alpha OS=Mus musculus GN=Scn9a PE=1 SV=2 360 536 3.0E-08
sp|A7S1H9|SDHF3_NEMVE Succinate dehydrogenase assembly factor 3, mitochondrial OS=Nematostella vectensis GN=acn9 PE=3 SV=1 1540 1667 3.0E-08
sp|Q9EQ60|CAC1H_RAT Voltage-dependent T-type calcium channel subunit alpha-1H OS=Rattus norvegicus GN=Cacna1h PE=2 SV=2 334 538 4.0E-08
sp|Q9NY46|SCN3A_HUMAN Sodium channel protein type 3 subunit alpha OS=Homo sapiens GN=SCN3A PE=1 SV=2 659 1038 7.0E-08
sp|Q9UQD0|SCN8A_HUMAN Sodium channel protein type 8 subunit alpha OS=Homo sapiens GN=SCN8A PE=1 SV=1 24 264 7.0E-08
sp|O54898|CAC1G_RAT Voltage-dependent T-type calcium channel subunit alpha-1G OS=Rattus norvegicus GN=Cacna1g PE=1 SV=2 334 545 8.0E-08
sp|O88427|CAC1H_MOUSE Voltage-dependent T-type calcium channel subunit alpha-1H OS=Mus musculus GN=Cacna1h PE=1 SV=3 334 538 9.0E-08
sp|Q62205|SCN9A_MOUSE Sodium channel protein type 9 subunit alpha OS=Mus musculus GN=Scn9a PE=1 SV=2 24 264 1.0E-07
sp|O88420|SCN8A_RAT Sodium channel protein type 8 subunit alpha OS=Rattus norvegicus GN=Scn8a PE=1 SV=1 24 264 2.0E-07
sp|Q9WTU3|SCN8A_MOUSE Sodium channel protein type 8 subunit alpha OS=Mus musculus GN=Scn8a PE=1 SV=1 24 264 2.0E-07
sp|Q99246|CAC1D_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1D OS=Mus musculus GN=Cacna1d PE=1 SV=3 20 531 2.0E-07
sp|Q2XVR3|SC4AA_DANRE Sodium channel protein type 4 subunit alpha A OS=Danio rerio GN=scn4aa PE=2 SV=2 735 1044 2.0E-07
sp|O95180|CAC1H_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1H OS=Homo sapiens GN=CACNA1H PE=1 SV=4 334 538 2.0E-07
sp|Q9JJV9|SCN5A_MOUSE Sodium channel protein type 5 subunit alpha OS=Mus musculus GN=Scn5a PE=1 SV=2 25 264 3.0E-07
sp|P15389|SCN5A_RAT Sodium channel protein type 5 subunit alpha OS=Rattus norvegicus GN=Scn5a PE=1 SV=1 25 264 3.0E-07
sp|Q2XVR7|SC4AA_TAKRU Sodium channel protein type 4 subunit alpha A OS=Takifugu rubripes GN=scn4aa PE=3 SV=1 735 1016 3.0E-07
sp|O73705|CAC1A_CHICK Voltage-dependent P/Q-type calcium channel subunit alpha-1A (Fragment) OS=Gallus gallus GN=CACNA1A PE=2 SV=1 1202 1304 3.0E-07
sp|Q99244|CAC1D_MESAU Voltage-dependent L-type calcium channel subunit alpha-1D OS=Mesocricetus auratus GN=CACNA1D PE=2 SV=2 20 531 4.0E-07
sp|Q14524|SCN5A_HUMAN Sodium channel protein type 5 subunit alpha OS=Homo sapiens GN=SCN5A PE=1 SV=2 24 264 5.0E-07
sp|Q2XVR5|SC4AA_TETNG Sodium channel protein type 4 subunit alpha A OS=Tetraodon nigroviridis GN=scn4aa PE=3 SV=2 24 274 5.0E-07
sp|Q01668|CAC1D_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1D OS=Homo sapiens GN=CACNA1D PE=1 SV=2 20 531 5.0E-07
sp|Q01118|SCN7A_HUMAN Sodium channel protein type 7 subunit alpha OS=Homo sapiens GN=SCN7A PE=1 SV=2 23 538 5.0E-07
sp|O73707|CAC1C_CHICK Voltage-dependent L-type calcium channel subunit alpha-1C (Fragment) OS=Gallus gallus GN=CACNA1C PE=2 SV=1 1150 1304 5.0E-07
sp|O88457|SCNBA_RAT Sodium channel protein type 11 subunit alpha OS=Rattus norvegicus GN=Scn11a PE=1 SV=1 659 960 6.0E-07
sp|Q2XVR7|SC4AA_TAKRU Sodium channel protein type 4 subunit alpha A OS=Takifugu rubripes GN=scn4aa PE=3 SV=1 24 273 6.0E-07
sp|Q61290|CAC1E_MOUSE Voltage-dependent R-type calcium channel subunit alpha-1E OS=Mus musculus GN=Cacna1e PE=1 SV=1 289 573 7.0E-07
sp|P27884|CAC1A_RABIT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Oryctolagus cuniculus GN=CACNA1A PE=1 SV=1 297 575 7.0E-07
sp|Q07652|CAC1E_RAT Voltage-dependent R-type calcium channel subunit alpha-1E OS=Rattus norvegicus GN=Cacna1e PE=1 SV=1 289 573 9.0E-07
sp|O73700|CAC1D_CHICK Voltage-dependent L-type calcium channel subunit alpha-1D OS=Gallus gallus GN=CACNA1D PE=2 SV=1 20 531 1.0E-06
sp|Q9P0X4|CAC1I_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1I OS=Homo sapiens GN=CACNA1I PE=1 SV=1 393 558 1.0E-06
sp|Q9Z0Y8|CAC1I_RAT Voltage-dependent T-type calcium channel subunit alpha-1I OS=Rattus norvegicus GN=Cacna1i PE=1 SV=3 393 538 1.0E-06
sp|Q28371|SCN4A_HORSE Sodium channel protein type 4 subunit alpha OS=Equus caballus GN=SCN4A PE=1 SV=1 24 263 1.0E-06
sp|O73706|CAC1B_CHICK Voltage-dependent N-type calcium channel subunit alpha-1B (Fragment) OS=Gallus gallus GN=CACNA1B PE=2 SV=1 1149 1304 1.0E-06
sp|Q15858|SCN9A_HUMAN Sodium channel protein type 9 subunit alpha OS=Homo sapiens GN=SCN9A PE=1 SV=3 24 264 2.0E-06
sp|Q9UI33|SCNBA_HUMAN Sodium channel protein type 11 subunit alpha OS=Homo sapiens GN=SCN11A PE=1 SV=2 301 552 2.0E-06
sp|Q15878|CAC1E_HUMAN Voltage-dependent R-type calcium channel subunit alpha-1E OS=Homo sapiens GN=CACNA1E PE=1 SV=3 289 573 2.0E-06
sp|P35498|SCN1A_HUMAN Sodium channel protein type 1 subunit alpha OS=Homo sapiens GN=SCN1A PE=1 SV=2 659 898 3.0E-06
sp|Q02294|CAC1B_RAT Voltage-dependent N-type calcium channel subunit alpha-1B OS=Rattus norvegicus GN=Cacna1b PE=1 SV=1 340 531 5.0E-06
sp|Q02343|CAC1E_RABIT Voltage-dependent R-type calcium channel subunit alpha-1E OS=Oryctolagus cuniculus GN=CACNA1E PE=2 SV=1 289 573 5.0E-06
sp|Q28644|SCN9A_RABIT Sodium channel protein type 9 subunit alpha OS=Oryctolagus cuniculus GN=SCN9A PE=2 SV=1 24 264 6.0E-06
sp|Q7RTX7|CTSR4_HUMAN Cation channel sperm-associated protein 4 OS=Homo sapiens GN=CATSPER4 PE=1 SV=1 267 531 7.0E-06
sp|O42398|CAC1S_CHICK Voltage-dependent L-type calcium channel subunit alpha-1S (Fragment) OS=Gallus gallus GN=CACNA1S PE=2 SV=1 1104 1271 8.0E-06
sp|Q02485|CAC1S_RAT Voltage-dependent L-type calcium channel subunit alpha-1S (Fragment) OS=Rattus norvegicus GN=Cacna1s PE=1 SV=1 311 531 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0006811 ion transport Yes
GO:0005216 ion channel activity Yes
GO:0055085 transmembrane transport Yes
GO:0015267 channel activity No
GO:0005215 transporter activity No
GO:0022803 passive transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0022857 transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.5

Transmembrane Domains

Domain # Start End Length
1 35 52 17
2 64 83 19
3 93 115 22
4 205 227 22
5 237 259 22
6 362 384 22
7 388 410 22
8 417 439 22
9 497 519 22
10 732 754 22
11 769 791 22
12 804 826 22
13 872 894 22
14 988 1010 22
15 1067 1086 19
16 1099 1121 22
17 1131 1150 19
18 1157 1174 17
19 1189 1211 22
20 1283 1305 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2271
MVSDDHQMPETQEEKQRLQLARRAFLRHSFNRLDFVAVVSYWIAFAIAVSGTEHRRHIYLFKMLSCLRILRLLAL
THGTAIILRSLKKAAPLLVRVAFLICFFWLLFAIIGVQSFKSSLSRQCVWLDPLDPKNLTASFTVELEFCGGHLD
NETGQTMPWVKFSSDESLDELVNGTGNGKGFICPRGSICLQQQGPFNGTVSFDDIFHSLELVFVIMSANTFADLM
YYTMGSDYLQAALFFGAGIMILMLWLTSLLIAVITSSFQVIREESKSSAFTVDPEPFAHPGPDERLRRPSTLQRL
YESTRIFWVIVIAFGLVCQSCRSSTMSRARETFIDLSEAIVTIVLDLEIIIRFTANWRRFHLSWQNIFDFGLAAI
TTIILIPPIRNSPAYQWLTVFQILRVYRVVLAIPVTRKLISLVLGNAAGIANLMLFVFLMTFLVAIFASQLFRGV
VPASKGNEANRITFATIYNSFLGMYQVLSSENWTEILYSVTAYTTEFRVAWIGAIFLIGWFVLSFFILVNMFIAV
IQENFDVSEDEKRLEQVRAFLQRKELGQTSSNIALSTIFSLGKSRRRRDPLDYGPAMMEMLLKDAVVRDFLNDDV
TNPLQDQTRSGGMAPRSATTLFGADVKPGFLSKLWAKISQRSSEQGPNPFYSNIRFDGPNETMDPRQMARQAVSA
TSARRKAQREYLACHPRYNDSLFVFRPKNPLRLICQRIVGPARGFERFDGVEPNKIAWYIFSMLVYAIVVAMVVL
ACVTTPLYQKEYRERHPSVVLGWYVWTDLAFAIFFTFEAAVKVVADGLLWTPNAYLRSSWGTIDSIVLLTLWINV
VTLLVNDGAISRAVGAFKALRALRLLNVSDSARDTFHSLIIVGWWKLFGAAFISLSLLIPFAVYGLNLFNGKMIA
CNDSDGVSVLDSCFGEYGSTPFKDDWLMLAPRVASNPYFNFDDFGSSLFTLFQIVSQEGWTDVSFAAQNIVGRGK
QPQNLAAQGNAMFFVVFNLMATVFVLTLFISVFMRNYTEQTGVAFLTAEQRSWLELRKLLRHISPSKSSYNGMEK
EWKRWCHKRAIEKRGKWYQAITVILVLHLLLLVAEFRTEPPWWSRTRVLAFLIFILIYLANISIRMIGLGWARFR
RSSWDLYSLVTVSGAFLATLALLIADTRGETYVQLHKFFLVAIVLLLIPRNDALDQLFKTAAASLTVIGNLLATW
LVLFLVFAIAMTQSFSLTRFGGEETGNVNFRTVPKALILLFRMSLGEGWNKVMEDYAEIEPPLCVEQHRFFNSDC
GSKAWARFLFVSWNIVSMYIFVNLFVSLIYESFSYVYQRSSGVAVVDREEIRRFKEAWRSVDPAGTGFITKEAFP
RLLGELSGVFQMRIYEPQDSVRQILEDVRGEDRTSRARNMSTRAYEEIDLEKLRKRLNLLDVEGIQKRRRRFKIF
YGEVLASADPDKGVAFPDVLMILAHYNIINDSKSLRLAEFLRRRARLQRVDEEIRRKIVQGFFDTLYWSRKFKKH
MERKRAARMSGVPGMPVPDILVDHDNTDDVSNPFNSEQASATRWTQLSVVLYRRVLRAHRKHLPAQLRQLGDNYV
MSEFRLHRNVDNPAQLVGRYAAHQAVAADVLTRRVSVCQVGFLTEWQLYAQKVEENSWAGDKLDQNFLDKMNEEQ
QQQVSDLMHANQKRDGSA*
Coding >Ophun1|2271
ATGGTGTCAGACGACCATCAAATGCCGGAAACGCAAGAAGAGAAGCAGAGACTGCAGCTTGCGCGCCGCGCTTTT
CTGCGTCACTCGTTCAACCGGCTGGACTTTGTCGCTGTCGTTTCTTATTGGATAGCCTTCGCCATCGCTGTCAGC
GGAACTGAACACCGTCGTCACATCTATTTGTTCAAGATGTTGAGTTGTCTGCGAATCCTACGCTTGCTGGCTCTC
ACGCACGGAACTGCGATAATCTTGAGAAGTCTGAAGAAGGCCGCGCCGCTTCTCGTTCGTGTTGCTTTCCTCATC
TGCTTCTTCTGGTTGCTTTTCGCCATTATCGGCGTTCAGAGCTTCAAGTCGAGTCTCAGCCGCCAATGCGTCTGG
CTTGATCCTCTGGATCCGAAAAACCTGACGGCATCTTTCACAGTGGAATTGGAGTTCTGTGGTGGTCACCTGGAT
AACGAAACCGGGCAGACTATGCCTTGGGTCAAGTTTAGCTCCGATGAGTCTCTGGATGAATTGGTCAATGGGACG
GGCAACGGCAAGGGATTCATCTGTCCACGCGGCTCCATCTGTCTGCAGCAACAAGGGCCTTTCAATGGCACCGTC
AGTTTCGATGACATCTTTCACTCGCTGGAGCTCGTCTTCGTTATCATGAGCGCCAACACGTTTGCCGACTTGATG
TATTATACGATGGGTTCCGACTATCTACAGGCCGCCCTCTTCTTCGGCGCCGGCATCATGATCTTGATGCTGTGG
CTGACAAGTCTCTTGATCGCTGTCATAACTTCGTCTTTTCAGGTCATTCGCGAGGAGAGCAAGTCGAGCGCTTTT
ACCGTCGATCCTGAGCCGTTTGCCCACCCCGGTCCGGACGAACGTTTGCGACGGCCTTCGACACTGCAACGACTA
TACGAGAGCACGAGAATATTCTGGGTCATTGTCATCGCATTTGGACTTGTCTGTCAATCATGTCGAAGTTCTACC
ATGTCCAGGGCACGCGAGACGTTCATTGACCTCAGCGAGGCCATTGTGACCATTGTCCTCGACCTGGAGATTATT
ATTCGCTTTACTGCAAATTGGCGAAGATTTCACTTGAGCTGGCAAAACATCTTCGATTTTGGTTTGGCGGCAATC
ACCACCATTATATTGATACCACCGATTCGCAATTCCCCCGCCTATCAATGGCTCACCGTCTTCCAGATCTTGCGA
GTCTACAGGGTCGTGTTAGCAATTCCCGTCACCCGGAAGTTGATATCACTGGTGCTGGGCAACGCCGCCGGTATT
GCGAACCTGATGCTCTTCGTCTTCCTCATGACCTTCTTGGTCGCCATCTTCGCTTCTCAGTTATTCAGGGGAGTT
GTGCCTGCCTCGAAAGGCAACGAAGCAAATCGCATCACCTTCGCCACGATATACAACTCCTTTCTCGGCATGTAT
CAAGTCCTGTCGAGCGAGAATTGGACCGAGATCCTCTATTCAGTCACTGCATACACCACAGAGTTCAGGGTGGCT
TGGATAGGTGCCATCTTTCTCATCGGGTGGTTCGTGCTTTCATTCTTCATTCTGGTCAACATGTTCATTGCTGTC
ATCCAAGAGAACTTTGACGTTTCCGAGGACGAGAAGCGCTTGGAGCAAGTCAGAGCGTTTCTGCAGAGAAAAGAA
TTGGGCCAGACATCCAGCAATATTGCGCTTTCCACGATATTCAGCTTGGGAAAATCACGTCGCCGCCGAGACCCC
CTAGATTACGGCCCAGCTATGATGGAGATGCTTCTGAAGGACGCTGTTGTGCGGGACTTTCTCAACGATGATGTG
ACGAATCCGCTCCAAGACCAAACAAGGTCCGGAGGCATGGCGCCGAGAAGCGCTACCACCCTGTTCGGAGCCGAC
GTGAAGCCCGGCTTCCTATCAAAGTTGTGGGCAAAGATATCGCAGCGCTCGAGCGAGCAAGGGCCAAACCCATTC
TATTCCAATATACGATTCGATGGTCCCAATGAAACCATGGACCCTCGGCAAATGGCCCGACAAGCTGTCTCAGCA
ACCTCTGCTCGGCGCAAGGCTCAGCGAGAGTACCTTGCCTGCCACCCTCGTTACAACGACTCTCTCTTCGTGTTT
CGACCCAAGAATCCCCTTCGACTGATTTGTCAACGAATTGTCGGTCCGGCCAGAGGCTTTGAGAGATTCGACGGC
GTCGAGCCCAACAAAATTGCCTGGTACATCTTCTCCATGCTGGTGTATGCGATCGTTGTAGCAATGGTCGTACTG
GCCTGTGTCACTACGCCGTTATACCAGAAAGAATACAGGGAGAGACATCCAAGTGTCGTCTTGGGATGGTACGTC
TGGACCGACTTGGCTTTCGCCATCTTCTTCACCTTTGAAGCCGCGGTAAAGGTTGTTGCAGATGGGCTTCTCTGG
ACACCCAACGCTTACCTGCGGAGCTCATGGGGCACAATTGACAGCATTGTCCTGTTGACACTTTGGATCAATGTT
GTCACTCTGCTGGTTAATGACGGCGCCATCTCGCGGGCTGTTGGCGCTTTCAAGGCCCTTCGAGCTCTGCGGCTT
CTCAATGTCAGCGACAGCGCAAGAGACACGTTTCATTCGTTGATCATTGTTGGCTGGTGGAAGCTGTTCGGAGCA
GCATTCATATCACTATCTCTCCTGATACCCTTTGCAGTCTATGGACTGAACCTGTTCAATGGGAAGATGATCGCC
TGCAATGATTCCGATGGCGTGTCGGTCCTGGATAGTTGTTTTGGCGAGTACGGCAGCACTCCTTTCAAAGACGAC
TGGCTCATGCTTGCTCCTCGAGTTGCGTCGAACCCTTATTTCAACTTTGACGACTTTGGATCTTCGCTCTTCACG
CTGTTTCAGATTGTGAGCCAAGAGGGATGGACAGATGTGTCGTTCGCCGCGCAGAATATCGTCGGCCGGGGCAAG
CAGCCTCAAAACCTTGCGGCTCAGGGAAATGCCATGTTTTTTGTCGTCTTCAACTTGATGGCGACCGTCTTCGTC
CTCACCCTCTTTATCTCGGTCTTCATGAGGAACTACACGGAGCAGACCGGAGTCGCCTTTCTTACCGCCGAACAA
AGATCTTGGCTCGAGCTGCGCAAGCTTCTGCGCCACATCTCGCCGTCCAAAAGCTCTTACAACGGCATGGAGAAG
GAATGGAAGAGATGGTGCCACAAGAGAGCCATTGAGAAACGGGGCAAGTGGTATCAAGCCATCACTGTCATTCTC
GTACTTCACCTCCTCCTGCTGGTGGCGGAATTCCGAACAGAACCGCCATGGTGGTCCCGCACTCGCGTGCTTGCG
TTTCTCATCTTCATCTTGATATATCTGGCAAACATCAGCATCCGGATGATTGGCCTTGGCTGGGCCAGATTTCGA
CGGAGCTCGTGGGATCTATACTCGCTTGTCACGGTGTCCGGGGCATTCTTGGCAACTCTGGCCCTCCTGATAGCT
GACACCAGGGGAGAGACCTATGTTCAGCTGCACAAATTTTTTCTCGTGGCCATTGTCCTGCTGCTGATACCGCGC
AACGACGCGTTGGATCAGCTCTTCAAGACGGCAGCGGCGAGTTTGACCGTCATCGGGAATTTGCTGGCCACTTGG
CTTGTTCTCTTTCTTGTCTTCGCCATCGCCATGACACAGTCGTTCAGCTTGACCCGCTTCGGGGGCGAGGAAACG
GGAAATGTCAACTTCCGCACGGTCCCCAAGGCCTTGATACTCTTGTTCCGAATGAGCCTCGGCGAGGGCTGGAAC
AAGGTCATGGAAGATTACGCCGAGATTGAACCTCCGCTGTGCGTCGAGCAACACAGATTCTTCAACAGTGACTGC
GGCAGCAAGGCCTGGGCTAGGTTCCTGTTCGTGTCGTGGAACATTGTGAGCATGTACATCTTTGTCAACCTGTTC
GTCTCCCTCATCTACGAGAGTTTCAGTTACGTCTATCAACGATCCAGCGGTGTCGCCGTGGTCGATAGAGAGGAG
ATACGCCGGTTCAAGGAAGCCTGGCGCAGCGTGGATCCCGCAGGTACTGGATTCATCACCAAGGAAGCCTTTCCG
CGTCTTCTCGGCGAGCTTTCGGGCGTCTTCCAGATGCGAATTTATGAGCCACAGGACTCGGTGAGACAGATATTG
GAAGACGTGCGCGGCGAGGATCGGACCTCGCGTGCGCGGAATATGTCAACGAGGGCTTATGAAGAAATCGATCTC
GAGAAGCTGAGAAAGAGATTGAACTTGCTGGACGTGGAAGGAATTCAGAAAAGGCGGCGGCGGTTCAAGATTTTC
TACGGAGAGGTATTGGCGTCTGCCGATCCAGACAAAGGTGTTGCCTTTCCAGACGTTTTGATGATTCTGGCGCAT
TACAACATCATCAATGACAGCAAAAGCCTCAGGCTTGCCGAGTTTCTTCGCCGCAGAGCGCGGCTGCAGCGCGTG
GACGAAGAGATACGGCGCAAGATCGTCCAGGGCTTCTTCGATACGCTATATTGGAGTAGGAAGTTCAAGAAGCAC
ATGGAACGCAAACGGGCAGCACGAATGTCAGGGGTGCCGGGGATGCCAGTTCCCGACATCTTGGTGGACCATGAC
AACACAGATGACGTGTCGAATCCGTTTAATTCCGAGCAAGCGTCCGCCACACGTTGGACGCAACTGAGCGTTGTC
CTTTACCGACGCGTGCTTCGAGCGCATCGGAAACATCTGCCAGCCCAATTGCGTCAACTAGGCGATAACTACGTC
ATGTCGGAATTCCGCTTGCATCGGAATGTCGATAACCCAGCTCAATTGGTAGGTCGCTACGCTGCTCATCAAGCC
GTGGCAGCCGACGTCCTGACGCGGCGAGTATCCGTCTGCCAGGTTGGCTTCCTCACGGAATGGCAGCTCTACGCC
CAAAAGGTGGAAGAGAACTCGTGGGCGGGCGACAAGCTCGATCAAAACTTCCTTGACAAGATGAACGAGGAGCAG
CAGCAGCAGGTCTCCGACTTGATGCACGCAAATCAGAAGCGAGATGGATCTGCATAG
Transcript >Ophun1|2271
ATGGTGTCAGACGACCATCAAATGCCGGAAACGCAAGAAGAGAAGCAGAGACTGCAGCTTGCGCGCCGCGCTTTT
CTGCGTCACTCGTTCAACCGGCTGGACTTTGTCGCTGTCGTTTCTTATTGGATAGCCTTCGCCATCGCTGTCAGC
GGAACTGAACACCGTCGTCACATCTATTTGTTCAAGATGTTGAGTTGTCTGCGAATCCTACGCTTGCTGGCTCTC
ACGCACGGAACTGCGATAATCTTGAGAAGTCTGAAGAAGGCCGCGCCGCTTCTCGTTCGTGTTGCTTTCCTCATC
TGCTTCTTCTGGTTGCTTTTCGCCATTATCGGCGTTCAGAGCTTCAAGTCGAGTCTCAGCCGCCAATGCGTCTGG
CTTGATCCTCTGGATCCGAAAAACCTGACGGCATCTTTCACAGTGGAATTGGAGTTCTGTGGTGGTCACCTGGAT
AACGAAACCGGGCAGACTATGCCTTGGGTCAAGTTTAGCTCCGATGAGTCTCTGGATGAATTGGTCAATGGGACG
GGCAACGGCAAGGGATTCATCTGTCCACGCGGCTCCATCTGTCTGCAGCAACAAGGGCCTTTCAATGGCACCGTC
AGTTTCGATGACATCTTTCACTCGCTGGAGCTCGTCTTCGTTATCATGAGCGCCAACACGTTTGCCGACTTGATG
TATTATACGATGGGTTCCGACTATCTACAGGCCGCCCTCTTCTTCGGCGCCGGCATCATGATCTTGATGCTGTGG
CTGACAAGTCTCTTGATCGCTGTCATAACTTCGTCTTTTCAGGTCATTCGCGAGGAGAGCAAGTCGAGCGCTTTT
ACCGTCGATCCTGAGCCGTTTGCCCACCCCGGTCCGGACGAACGTTTGCGACGGCCTTCGACACTGCAACGACTA
TACGAGAGCACGAGAATATTCTGGGTCATTGTCATCGCATTTGGACTTGTCTGTCAATCATGTCGAAGTTCTACC
ATGTCCAGGGCACGCGAGACGTTCATTGACCTCAGCGAGGCCATTGTGACCATTGTCCTCGACCTGGAGATTATT
ATTCGCTTTACTGCAAATTGGCGAAGATTTCACTTGAGCTGGCAAAACATCTTCGATTTTGGTTTGGCGGCAATC
ACCACCATTATATTGATACCACCGATTCGCAATTCCCCCGCCTATCAATGGCTCACCGTCTTCCAGATCTTGCGA
GTCTACAGGGTCGTGTTAGCAATTCCCGTCACCCGGAAGTTGATATCACTGGTGCTGGGCAACGCCGCCGGTATT
GCGAACCTGATGCTCTTCGTCTTCCTCATGACCTTCTTGGTCGCCATCTTCGCTTCTCAGTTATTCAGGGGAGTT
GTGCCTGCCTCGAAAGGCAACGAAGCAAATCGCATCACCTTCGCCACGATATACAACTCCTTTCTCGGCATGTAT
CAAGTCCTGTCGAGCGAGAATTGGACCGAGATCCTCTATTCAGTCACTGCATACACCACAGAGTTCAGGGTGGCT
TGGATAGGTGCCATCTTTCTCATCGGGTGGTTCGTGCTTTCATTCTTCATTCTGGTCAACATGTTCATTGCTGTC
ATCCAAGAGAACTTTGACGTTTCCGAGGACGAGAAGCGCTTGGAGCAAGTCAGAGCGTTTCTGCAGAGAAAAGAA
TTGGGCCAGACATCCAGCAATATTGCGCTTTCCACGATATTCAGCTTGGGAAAATCACGTCGCCGCCGAGACCCC
CTAGATTACGGCCCAGCTATGATGGAGATGCTTCTGAAGGACGCTGTTGTGCGGGACTTTCTCAACGATGATGTG
ACGAATCCGCTCCAAGACCAAACAAGGTCCGGAGGCATGGCGCCGAGAAGCGCTACCACCCTGTTCGGAGCCGAC
GTGAAGCCCGGCTTCCTATCAAAGTTGTGGGCAAAGATATCGCAGCGCTCGAGCGAGCAAGGGCCAAACCCATTC
TATTCCAATATACGATTCGATGGTCCCAATGAAACCATGGACCCTCGGCAAATGGCCCGACAAGCTGTCTCAGCA
ACCTCTGCTCGGCGCAAGGCTCAGCGAGAGTACCTTGCCTGCCACCCTCGTTACAACGACTCTCTCTTCGTGTTT
CGACCCAAGAATCCCCTTCGACTGATTTGTCAACGAATTGTCGGTCCGGCCAGAGGCTTTGAGAGATTCGACGGC
GTCGAGCCCAACAAAATTGCCTGGTACATCTTCTCCATGCTGGTGTATGCGATCGTTGTAGCAATGGTCGTACTG
GCCTGTGTCACTACGCCGTTATACCAGAAAGAATACAGGGAGAGACATCCAAGTGTCGTCTTGGGATGGTACGTC
TGGACCGACTTGGCTTTCGCCATCTTCTTCACCTTTGAAGCCGCGGTAAAGGTTGTTGCAGATGGGCTTCTCTGG
ACACCCAACGCTTACCTGCGGAGCTCATGGGGCACAATTGACAGCATTGTCCTGTTGACACTTTGGATCAATGTT
GTCACTCTGCTGGTTAATGACGGCGCCATCTCGCGGGCTGTTGGCGCTTTCAAGGCCCTTCGAGCTCTGCGGCTT
CTCAATGTCAGCGACAGCGCAAGAGACACGTTTCATTCGTTGATCATTGTTGGCTGGTGGAAGCTGTTCGGAGCA
GCATTCATATCACTATCTCTCCTGATACCCTTTGCAGTCTATGGACTGAACCTGTTCAATGGGAAGATGATCGCC
TGCAATGATTCCGATGGCGTGTCGGTCCTGGATAGTTGTTTTGGCGAGTACGGCAGCACTCCTTTCAAAGACGAC
TGGCTCATGCTTGCTCCTCGAGTTGCGTCGAACCCTTATTTCAACTTTGACGACTTTGGATCTTCGCTCTTCACG
CTGTTTCAGATTGTGAGCCAAGAGGGATGGACAGATGTGTCGTTCGCCGCGCAGAATATCGTCGGCCGGGGCAAG
CAGCCTCAAAACCTTGCGGCTCAGGGAAATGCCATGTTTTTTGTCGTCTTCAACTTGATGGCGACCGTCTTCGTC
CTCACCCTCTTTATCTCGGTCTTCATGAGGAACTACACGGAGCAGACCGGAGTCGCCTTTCTTACCGCCGAACAA
AGATCTTGGCTCGAGCTGCGCAAGCTTCTGCGCCACATCTCGCCGTCCAAAAGCTCTTACAACGGCATGGAGAAG
GAATGGAAGAGATGGTGCCACAAGAGAGCCATTGAGAAACGGGGCAAGTGGTATCAAGCCATCACTGTCATTCTC
GTACTTCACCTCCTCCTGCTGGTGGCGGAATTCCGAACAGAACCGCCATGGTGGTCCCGCACTCGCGTGCTTGCG
TTTCTCATCTTCATCTTGATATATCTGGCAAACATCAGCATCCGGATGATTGGCCTTGGCTGGGCCAGATTTCGA
CGGAGCTCGTGGGATCTATACTCGCTTGTCACGGTGTCCGGGGCATTCTTGGCAACTCTGGCCCTCCTGATAGCT
GACACCAGGGGAGAGACCTATGTTCAGCTGCACAAATTTTTTCTCGTGGCCATTGTCCTGCTGCTGATACCGCGC
AACGACGCGTTGGATCAGCTCTTCAAGACGGCAGCGGCGAGTTTGACCGTCATCGGGAATTTGCTGGCCACTTGG
CTTGTTCTCTTTCTTGTCTTCGCCATCGCCATGACACAGTCGTTCAGCTTGACCCGCTTCGGGGGCGAGGAAACG
GGAAATGTCAACTTCCGCACGGTCCCCAAGGCCTTGATACTCTTGTTCCGAATGAGCCTCGGCGAGGGCTGGAAC
AAGGTCATGGAAGATTACGCCGAGATTGAACCTCCGCTGTGCGTCGAGCAACACAGATTCTTCAACAGTGACTGC
GGCAGCAAGGCCTGGGCTAGGTTCCTGTTCGTGTCGTGGAACATTGTGAGCATGTACATCTTTGTCAACCTGTTC
GTCTCCCTCATCTACGAGAGTTTCAGTTACGTCTATCAACGATCCAGCGGTGTCGCCGTGGTCGATAGAGAGGAG
ATACGCCGGTTCAAGGAAGCCTGGCGCAGCGTGGATCCCGCAGGTACTGGATTCATCACCAAGGAAGCCTTTCCG
CGTCTTCTCGGCGAGCTTTCGGGCGTCTTCCAGATGCGAATTTATGAGCCACAGGACTCGGTGAGACAGATATTG
GAAGACGTGCGCGGCGAGGATCGGACCTCGCGTGCGCGGAATATGTCAACGAGGGCTTATGAAGAAATCGATCTC
GAGAAGCTGAGAAAGAGATTGAACTTGCTGGACGTGGAAGGAATTCAGAAAAGGCGGCGGCGGTTCAAGATTTTC
TACGGAGAGGTATTGGCGTCTGCCGATCCAGACAAAGGTGTTGCCTTTCCAGACGTTTTGATGATTCTGGCGCAT
TACAACATCATCAATGACAGCAAAAGCCTCAGGCTTGCCGAGTTTCTTCGCCGCAGAGCGCGGCTGCAGCGCGTG
GACGAAGAGATACGGCGCAAGATCGTCCAGGGCTTCTTCGATACGCTATATTGGAGTAGGAAGTTCAAGAAGCAC
ATGGAACGCAAACGGGCAGCACGAATGTCAGGGGTGCCGGGGATGCCAGTTCCCGACATCTTGGTGGACCATGAC
AACACAGATGACGTGTCGAATCCGTTTAATTCCGAGCAAGCGTCCGCCACACGTTGGACGCAACTGAGCGTTGTC
CTTTACCGACGCGTGCTTCGAGCGCATCGGAAACATCTGCCAGCCCAATTGCGTCAACTAGGCGATAACTACGTC
ATGTCGGAATTCCGCTTGCATCGGAATGTCGATAACCCAGCTCAATTGGTAGGTCGCTACGCTGCTCATCAAGCC
GTGGCAGCCGACGTCCTGACGCGGCGAGTATCCGTCTGCCAGGTTGGCTTCCTCACGGAATGGCAGCTCTACGCC
CAAAAGGTGGAAGAGAACTCGTGGGCGGGCGACAAGCTCGATCAAAACTTCCTTGACAAGATGAACGAGGAGCAG
CAGCAGCAGGTCTCCGACTTGATGCACGCAAATCAGAAGCGAGATGGATCTGCATAG
Gene >Ophun1|2271
ATGGTGTCAGACGACCATCAAATGCCGGAAACGCAAGAAGAGAAGCAGAGACTGCAGCTTGCGCGCCGCGCTTTT
CTGCGTCACTCGTTCAACCGGCTGGACTTTGTCGCTGTCGTTTCTTATTGGATAGCCTTCGCCATCGCTGTCAGC
GGAACTGAACACCGTCGTCACATCTATTTGTTCAAGATGTTGAGTTGTCTGCGAATCCTACGCTTGCTGGCTCTC
ACGCACGGAACTGCGGTAAGTGAACGAGAATGGATAGCCGCGATAGCCTCTTACTGACAGTAGTCAGATAATCTT
GAGAAGTCTGAAGAAGGCCGCGCCGCTTCTCGTTCGTGTTGCTTTCCTCATCTGCTTCTTCTGGTTGCTTTTCGC
CATTATCGGCGTTCAGAGCTTCAAGTCGAGTCTCAGCCGCCAATGCGTCTGGCTTGATCCTCTGGATCCGAAAAA
CCTGACGGCATCTTTCACAGTGGAATTGGAGTTCTGTGGTGGTCACCTGGATAACGAAACCGGGCAGACTATGCC
TTGGGTCAAGTTTAGCTCCGATGAGTCTCTGGATGAATTGGTCAATGGGACGGGCAACGGCAAGGGATTCATCTG
TCCACGCGGCTCCATCTGTCTGCAGCAACAAGGGCCTTTCAATGGCACCGTCAGTTTCGATGACATCTTTCACTC
GCTGGAGCTCGTCTTCGTTATCATGAGCGCCAACACGTTTGCCGACTTGATGTATTATACGATGGGTTCCGACTA
TCTACAGGCCGCCCTCTTCTTCGGCGCCGGCATCATGATCTTGATGCTGTGGCTGACAAGTCTCTTGATCGCTGT
CATAACTTCGTCTTTTCAGGTCATTCGCGAGGAGAGCAAGTCGAGCGCTTTTACCGTCGATCCTGAGCCGTTTGC
CCACCCCGGTCCGGACGAACGTTTGCGACGGCCTTCGACACTGCAACGACTATACGAGAGCACGAGAATATTCTG
GGTCATTGTCATCGCATTTGGACTTGTCTGTCAATCATGTCGAAGTTCTACCATGTCCAGGGCACGCGAGACGTT
CATTGACCTCAGCGAGGCCATTGTGACCATTGTCCTCGACCTGGAGATTATTATTCGCTTTACTGCAAATTGGCG
AAGATTTCACTTGAGCTGGCAAAACATCTTCGATTTTGGTTTGGCGGCAATCACCACCATTATATTGATACCACC
GATTCGCAATTCCCCCGCCTATCAATGGCTCACCGTCTTCCAGATCTTGCGAGTCTACAGGGTCGTGTTAGCAAT
TCCCGTCACCCGGAAGTTGATATCACTGGTGCTGGGCAACGCCGCCGGTATTGCGAACCTGATGCTCTTCGTCTT
CCTCATGACCTTCTTGGTCGCCATCTTCGCTTCTCAGTTATTCAGGGGAGTTGTGCCTGCCTCGAAAGGCAACGA
AGCAAATCGCATCACCTTCGCCACGATATACAACTCCTTTCTCGGCATGTATCAAGTCCTGTCGAGCGAGAATTG
GACCGAGATCCTCTATTCAGTCACTGCATACACCACAGAGTTCAGGGTGGCTTGGATAGGTGCCATCTTTCTCAT
CGGGTGGTTCGTGCTTTCATTCTTCATTCTGGTCAACATGTTCATTGCTGTCATCCAAGAGAACTTTGACGTTTC
CGAGGACGAGAAGCGCTTGGAGCAAGTCAGAGCGTTTCTGCAGAGAAAAGAATTGGGCCAGACATCCAGCAATAT
TGCGCTTTCCACGATATTCAGCTTGGGAAAATCACGTCGCCGCCGAGACCCCCTAGATTACGGCCCAGCTATGAT
GGAGATGCTTCTGAAGGACGCTGTTGTGCGGGACTTTCTCAACGATGATGTGACGAATCCGCTCCAAGACCAAAC
AAGGTCCGGAGGCATGGCGCCGAGAAGCGCTACCACCCTGTTCGGAGCCGACGTGAAGCCCGGCTTCCTATCAAA
GTTGTGGGCAAAGATATCGCAGCGCTCGAGCGAGCAAGGGCCAAACCCATTCTATTCCAATATACGATTCGATGG
TCCCAATGAAACCATGGACCCTCGGCAAATGGCCCGACAAGCTGTCTCAGCAACCTCTGCTCGGCGCAAGGCTCA
GCGAGAGTACCTTGCCTGCCACCCTCGTTACAACGACTCTCTCTTCGTGTTTCGACCCAAGAATCCCCTTCGACT
GATTTGTCAACGAATTGTCGGTCCGGCCAGAGGCTTTGAGAGATTCGACGGCGTCGAGCCCAACAAAATTGCCTG
GTACATCTTCTCCATGCTGGTGTATGCGATCGTTGTAGCAATGGTCGTACTGGCCTGTGTCACTACGCCGTTATA
CCAGAAAGAATACAGGGAGAGACATCCAAGTGTCGTCTTGGGATGGTACGTCTGGACCGACTTGGCTTTCGCCAT
CTTCTTCACCTTTGAAGCCGCGGTAAAGGTTGTTGCAGATGGGCTTCTCTGGACACCCAACGCTTACCTGCGGAG
CTCATGGGGCACAATTGACAGCATTGTCCTGTTGACACTTTGGATCAATGTTGTCACTCTGCTGGTTAATGACGG
CGCCATCTCGCGGGCTGTTGGCGCTTTCAAGGCCCTTCGAGCTCTGCGGCTTCTCAATGTCAGCGACAGCGCAAG
AGACACGTTTCATTCGTTGATCATTGTTGGCTGGTGGAAGCTGTTCGGAGTAAGTGCCCTTCTTTCTGTCTTGCG
CACATGCTAATGGCATCGTTTGGTGCAGGCAGCATTCATATCACTATCTCTCCTGATACCCTTTGCAGTCTATGG
ACTGAACCTGTTCAATGGGAAGATGATCGCCTGCAATGATTCCGATGGCGTGTCGGTCCTGGATAGTTGTTTTGG
CGAGTACGGCAGCACTCCTTTCAAAGACGACTGGCTCATGCTTGCTCCTCGAGTTGCGTCGAACCCTTATTTCAA
CTTTGACGACTTTGGATCTTCGCTCTTCACGCTGTTTCAGATTGTGAGCCAAGAGGGATGGACAGATGTGTCGTT
CGCCGCGCAGAATATCGTCGGCCGGGGCAAGCAGCCTCAAAACCTTGCGGCTCAGGGAAATGCCATGTTTTTTGT
CGTCTTCAACTTGATGGCGACCGTCTTCGTCCTCACCCTCTTTATCTCGGTCTTCATGAGGAACTACACGGAGCA
GACCGGAGTCGCCTTTCTTACCGCCGAACAAAGATCTTGGCTCGAGCTGCGCAAGCTTCTGCGCCACATCTCGCC
GTCCAAAAGCTCTTACAACGGCATGGAGAAGGAATGGAAGAGATGGTGCCACAAGAGAGCCATTGAGAAACGGGG
CAAGTGGTATCAAGCCATCACTGTCATTCTCGTACTTCACCTCCTCCTGCTGGTGGCGGAATTCCGAACAGAACC
GCCATGGTGGTCCCGCACTCGCGTGCTTGCGTTTCTCATCTTCATCTTGATATATCTGGCAAACATCAGCATCCG
GATGATTGGCCTTGGCTGGGCCAGATTTCGACGGAGCTCGTGGGATCTATACTCGCTTGTCACGGTGTCCGGGGC
ATTCTTGGCAACTCTGGCCCTCCTGATAGCTGACACCAGGGGAGAGACCTATGTTCAGCTGCACAAATTTTTTCT
CGTGGCCATTGTCCTGCTGCTGATACCGCGCAACGACGCGTTGGATCAGCTCTTCAAGACGGCAGCGGCGAGTTT
GACCGTCATCGGGAATTTGCTGGCCACTTGGCTTGTTCTCTTTCTTGTCTTCGCCATCGCCATGACACAGTCGTT
CAGCTTGACCCGCTTCGGGGGCGAGGAAACGGGAAATGTCAACTTCCGCACGGTCCCCAAGGCCTTGATACTCTT
GTTCCGAATGAGCCTCGGCGAGGGCTGGAACAAGGTCATGGAAGATTACGCCGAGATTGAACCTCCGCTGTGCGT
CGAGCAACACAGATTCTTCAACAGTGACTGCGGCAGCAAGGCCTGGGCTAGGTTCCTGTTCGTGTCGTGGAACAT
TGTGAGCATGTACATCTTTGTCAACCTGTTCGTCTCCCTCATCTACGAGAGTTTCAGTTACGTCTATCAACGATC
CAGCGGTGTCGCCGTGGTCGATAGAGAGGAGATACGCCGGTTCAAGGAAGCCTGGCGCAGCGTGGATCCCGCAGG
TACTGGATTCATCACCAAGGAAGCCTTTCCGCGTCTTCTCGGCGAGCTTTCGGGCGTCTTCCAGATGCGAATTTA
TGAGCCACAGGACTCGGTGAGACAGATATTGGAAGACGTGCGCGGCGAGGATCGGACCTCGCGTGCGCGGAATAT
GTCAACGAGGGCTTATGAAGAAATCGATCTCGAGAAGCTGAGAAAGAGATTGAACTTGCTGGACGTGGAAGGAAT
TCAGAAAAGGCGGCGGCGGTTCAAGATTTTCTACGGAGAGGTATTGGCGTCTGCCGATCCAGACAAAGGTGTTGC
CTTTCCAGACGTTTTGATGATTCTGGCGCATTACAACATCATCAATGACAGCAAAAGCCTCAGGTGTGTGACGGA
AAACTCTGGCGGGAAGACTCGTGCTTCGACACTGACACTGTCTCCCTTTAGGCTTGCCGAGTTTCTTCGCCGCAG
AGCGCGGCTGCAGCGCGTGGACGAAGAGATACGGCGCAAGATCGTCCAGGGCTTCTTCGATACGCTGTGAGTCAA
ACGCAGCACTCCGGTCTCCCTGAGAGTCAAGCTGACTGAAATCGATATAGATATTGGAGTAGGAAGTTCAAGAAG
CACATGGAACGCAAACGGGCAGCACGAATGTCAGGGGTGCCGGGGATGCCAGTTCCCGACATCTTGGTGGACCAT
GACAACACAGATGACGTGTCGAATCCGTTTAATTCCGAGCAAGCGTCCGCCACACGTTGGACGCAACTGAGCGTT
GGTGAAGGGGCCATGCACAATACGACGACGAGTGCGGCGGAAGCACGTCAAGGAGGGACAGGATACCAACATCCG
CTGAGCCATTCTCGGTCATCGACGTGCACGGCGACGGGCCAGGGTGCCGCTTCAGGGTTCAGTTTCGAGATATAC
GAGCCTGAAAGTCGACATCATGGTCAAGATGGATGGAACGAGAGTCGTGGAGAGAGTGGGATGAGCCCGTCACAA
GCTCGGGACATTGTGGACGATTCGGTTTGGGTGGACAGCATCAGACGCAGTGCCACGCTTCGAAGGTCCATCAGG
GGCTCGCGATGATGGGAGGAGTCTCAAGAGGCATCTGATGATCTCTTGAGTTCTCACGGCTCCTTCGCTGACAAC
AAGAGGTAATTGAGCGTTCTTCGAGGCGTTTAAAGGTGCTTGGACATATTGGGATACCTGTGTGTACGAATACAA
AGTGTGTATGAATAGGATTGCTTACGTACATGATCAGTCCAGCTGAGGCTGAGGCTCATTCGGAGTCGTCGCCCT
GTACGAATACCGCCACCAAGCATCACATCACCCGGTATCCAGATGCTGTGGCATCTCCCTAGAGCTACGCAACGA
TGTCTGCACGTCCCCTCCACGGCTCTGCTCCCGCCTAAAGTCCTTTACCGACGCGTGCTTCGAGCGCATCGGAAA
CATCTGCCAGCCCAATTGCGTCAACTAGGCGATAACTACGTCATGTCGGAATTCCGCTTGCATCGGAATGTCGAT
AACCCAGCTCAATTGGTAGGTCGCTACGCTGCTCATCAAGCCGTGGCAGCCGACGTCCTGACGCGGCGAGTATCC
GTCTGCCAGGTTGGCTTCCTCACGGAATGGCAGCTCTACGCCCAAAAGGTGGAAGAGAACTCGTGGGCGGGCGAC
AAGCTCGATCAAAACTTCCTTGACAAGATGAACGGTGAGCCGCGACGTCCGGTTGATGAGTTCCCGGTTGGGAAG
TATGCACGAGGCTCATTGGCAGCAGAGGAGCAGCAGCAGCAGGTCTCCGACTTGATGCACGCAAATCAGAAGCGA
GATGGATCTGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail