Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2264
Gene name
LocationContig_209:18151..19660
Strand-
Gene length (bp)1509
Transcript length (bp)1356
Coding sequence length (bp)1356
Protein length (aa) 452

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop 1.1E-31 131 338
PF16573 CLP1_N N-terminal beta-sandwich domain of polyadenylation factor 2.0E-26 22 115
PF06807 Clp1 Pre-mRNA cleavage complex II protein Clp1 9.4E-25 345 444

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4QQE0|CLP1_MAGO7 mRNA cleavage and polyadenylation factor CLP1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CLP1 PE=3 SV=2 1 451 3.0E-151
sp|A6S936|CLP1_BOTFB mRNA cleavage and polyadenylation factor clp1 OS=Botryotinia fuckeliana (strain B05.10) GN=clp1 PE=3 SV=1 1 451 2.0E-146
sp|Q2H1L0|CLP1_CHAGB mRNA cleavage and polyadenylation factor CLP1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CLP1 PE=3 SV=1 1 451 8.0E-143
sp|Q7SAB7|CLP1_NEUCR mRNA cleavage and polyadenylation factor clp1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-7 PE=3 SV=1 1 450 3.0E-126
sp|A2RAW3|CLP1_ASPNC mRNA cleavage and polyadenylation factor clp1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=clp1 PE=3 SV=1 1 437 9.0E-113
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4QQE0|CLP1_MAGO7 mRNA cleavage and polyadenylation factor CLP1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CLP1 PE=3 SV=2 1 451 3.0E-151
sp|A6S936|CLP1_BOTFB mRNA cleavage and polyadenylation factor clp1 OS=Botryotinia fuckeliana (strain B05.10) GN=clp1 PE=3 SV=1 1 451 2.0E-146
sp|Q2H1L0|CLP1_CHAGB mRNA cleavage and polyadenylation factor CLP1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CLP1 PE=3 SV=1 1 451 8.0E-143
sp|Q7SAB7|CLP1_NEUCR mRNA cleavage and polyadenylation factor clp1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-7 PE=3 SV=1 1 450 3.0E-126
sp|A2RAW3|CLP1_ASPNC mRNA cleavage and polyadenylation factor clp1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=clp1 PE=3 SV=1 1 437 9.0E-113
sp|Q0U2G5|CLP1_PHANO mRNA cleavage and polyadenylation factor CLP1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CLP1 PE=3 SV=1 1 451 6.0E-111
sp|A1CB93|CLP1_ASPCL mRNA cleavage and polyadenylation factor clp1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=clp1 PE=3 SV=1 1 451 1.0E-108
sp|Q5BH19|CLP1_EMENI mRNA cleavage and polyadenylation factor clp1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=clp1 PE=3 SV=2 1 451 5.0E-107
sp|Q2UEA6|CLP1_ASPOR mRNA cleavage and polyadenylation factor clp1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=clp1 PE=3 SV=1 1 451 8.0E-102
sp|Q0CEZ9|CLP1_ASPTN mRNA cleavage and polyadenylation factor clp1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=clp1 PE=3 SV=2 1 371 6.0E-99
sp|A1DE49|CLP1_NEOFI mRNA cleavage and polyadenylation factor clp1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=clp1 PE=3 SV=1 1 361 2.0E-93
sp|Q1DKL9|CLP1_COCIM mRNA cleavage and polyadenylation factor CLP1 OS=Coccidioides immitis (strain RS) GN=CLP1 PE=3 SV=2 1 360 4.0E-88
sp|Q4WVA5|CLP1_ASPFU mRNA cleavage and polyadenylation factor clp1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=clp1 PE=3 SV=1 1 361 5.0E-88
sp|B0Y0Y6|CLP1_ASPFC mRNA cleavage and polyadenylation factor clp1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=clp1 PE=3 SV=1 1 361 7.0E-88
sp|Q10299|CLP1_SCHPO mRNA cleavage and polyadenylation factor clp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=clp1 PE=3 SV=1 19 444 8.0E-81
sp|Q6BZT5|CLP1_YARLI mRNA cleavage and polyadenylation factor CLP1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CLP1 PE=3 SV=1 1 440 1.0E-76
sp|Q59ST8|CLP1_CANAL mRNA cleavage and polyadenylation factor CLP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLP1 PE=3 SV=1 1 438 4.0E-71
sp|Q6BU98|CLP1_DEBHA mRNA cleavage and polyadenylation factor CLP1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CLP1 PE=3 SV=2 2 438 3.0E-66
sp|A5DJW8|CLP1_PICGU mRNA cleavage and polyadenylation factor CLP1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=CLP1 PE=3 SV=2 1 428 2.0E-64
sp|A3LNJ3|CLP1_PICST mRNA cleavage and polyadenylation factor CLP1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=CLP1 PE=3 SV=3 1 438 8.0E-63
sp|A7TH62|CLP1_VANPO mRNA cleavage and polyadenylation factor CLP1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CLP1 PE=3 SV=1 1 442 1.0E-62
sp|A6ZP88|CLP1_YEAS7 mRNA cleavage and polyadenylation factor CLP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=CLP1 PE=3 SV=1 28 442 2.0E-56
sp|Q08685|CLP1_YEAST mRNA cleavage and polyadenylation factor CLP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLP1 PE=1 SV=1 28 442 2.0E-56
sp|Q6CTU5|CLP1_KLULA mRNA cleavage and polyadenylation factor CLP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CLP1 PE=3 SV=1 14 442 2.0E-56
sp|Q9SR06|CLP1_ARATH Protein CLP1 homolog OS=Arabidopsis thaliana GN=CLPS3 PE=1 SV=1 1 440 5.0E-56
sp|A2VE01|CLP1_BOVIN Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Bos taurus GN=CLP1 PE=2 SV=1 18 427 8.0E-56
sp|Q5ZJL4|CLP1_CHICK Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Gallus gallus GN=CLP1 PE=2 SV=2 23 427 2.0E-55
sp|Q54N48|CLP1_DICDI Protein CLP1 homolog OS=Dictyostelium discoideum GN=clp1 PE=3 SV=1 22 444 2.0E-55
sp|Q5PQL4|CLP1_RAT Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Rattus norvegicus GN=Clp1 PE=2 SV=1 18 427 2.0E-55
sp|Q99LI9|CLP1_MOUSE Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Mus musculus GN=Clp1 PE=1 SV=1 18 427 2.0E-55
sp|Q4R7R3|CLP1_MACFA Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Macaca fascicularis GN=CLP1 PE=2 SV=1 18 427 3.0E-55
sp|Q92989|CLP1_HUMAN Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Homo sapiens GN=CLP1 PE=1 SV=1 18 427 3.0E-55
sp|Q6FMC8|CLP1_CANGA mRNA cleavage and polyadenylation factor CLP1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CLP1 PE=3 SV=1 2 439 3.0E-54
sp|Q6NS21|CLP1_XENLA Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Xenopus laevis GN=clp1 PE=2 SV=1 10 427 5.0E-54
sp|Q66JK4|CLP1_XENTR Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Xenopus tropicalis GN=clp1 PE=2 SV=1 10 427 3.0E-53
sp|Q75F23|CLP1_ASHGO mRNA cleavage and polyadenylation factor CLP1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CLP1 PE=3 SV=1 16 442 2.0E-51
sp|E7F3I6|CLP1_DANRE Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Danio rerio GN=clp1 PE=1 SV=1 23 427 2.0E-51
sp|B4KML2|CLP1_DROMO Protein CLP1 homolog OS=Drosophila mojavensis GN=cbc PE=3 SV=1 28 444 2.0E-49
sp|B0CS49|CLP1_LACBS mRNA cleavage and polyadenylation factor CLP1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=CLP1 PE=3 SV=1 15 444 3.0E-49
sp|B4JVN0|CLP1_DROGR Protein CLP1 homolog OS=Drosophila grimshawi GN=cbc PE=3 SV=1 16 444 4.0E-49
sp|A5DY33|CLP1_LODEL mRNA cleavage and polyadenylation factor CLP1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=CLP1 PE=3 SV=1 1 430 4.0E-49
sp|Q7QJW7|CLP1_ANOGA Protein CLP1 homolog OS=Anopheles gambiae GN=cbc PE=3 SV=2 23 427 6.0E-49
sp|B4MRZ9|CLP1_DROWI Protein CLP1 homolog OS=Drosophila willistoni GN=cbc PE=3 SV=1 16 444 4.0E-48
sp|B4HQJ2|CLP1_DROSE Protein CLP1 homolog OS=Drosophila sechellia GN=cbc PE=3 SV=1 19 444 6.0E-48
sp|B4P4H2|CLP1_DROYA Protein CLP1 homolog OS=Drosophila yakuba GN=cbc PE=3 SV=1 19 444 2.0E-47
sp|Q16WA6|CLP1_AEDAE Protein CLP1 homolog OS=Aedes aegypti GN=cbc PE=3 SV=1 23 427 4.0E-47
sp|B4GGT6|CLP1_DROPE Protein CLP1 homolog OS=Drosophila persimilis GN=cbc PE=3 SV=1 16 444 5.0E-47
sp|Q28ZT4|CLP1_DROPS Protein CLP1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=cbc PE=3 SV=1 19 444 6.0E-47
sp|A7RG82|CLP1_NEMVE Protein CLP1 homolog OS=Nematostella vectensis GN=v1g236308 PE=3 SV=1 23 441 8.0E-47
sp|Q7K284|CLP1_DROME Protein CLP1 homolog OS=Drosophila melanogaster GN=cbc PE=2 SV=1 19 444 9.0E-47
sp|B4QEE3|CLP1_DROSI Protein CLP1 homolog OS=Drosophila simulans GN=cbc PE=3 SV=1 19 444 9.0E-47
sp|B4MCL6|CLP1_DROVI Protein CLP1 homolog OS=Drosophila virilis GN=cbc PE=3 SV=1 16 444 2.0E-46
sp|B3MGZ0|CLP1_DROAN Protein CLP1 homolog OS=Drosophila ananassae GN=cbc PE=3 SV=1 16 444 2.0E-46
sp|B0VZR4|CLP1_CULQU Protein CLP1 homolog OS=Culex quinquefasciatus GN=cbc PE=3 SV=1 17 427 3.0E-46
sp|B3NRK6|CLP1_DROER Protein CLP1 homolog OS=Drosophila erecta GN=cbc PE=3 SV=1 19 444 2.0E-45
sp|A8PB32|CLP1_BRUMA Protein CLP1 homolog OS=Brugia malayi GN=Bm1_20975 PE=3 SV=1 17 441 5.0E-45
sp|P52874|CLP1_CAEEL Protein clpf-1 OS=Caenorhabditis elegans GN=clpf-1 PE=1 SV=2 17 427 2.0E-42
sp|Q9FLE2|CLP5_ARATH Protein CLP1 homolog 5 OS=Arabidopsis thaliana GN=CLPS5 PE=1 SV=1 19 440 3.0E-41
sp|A8X9U4|CLP1_CAEBR Protein clpf-1 OS=Caenorhabditis briggsae GN=clpf-1 PE=3 SV=2 23 427 1.0E-40
sp|Q4P9Z3|CLP1_USTMA mRNA cleavage and polyadenylation factor CLP1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CLP1 PE=3 SV=1 15 440 2.0E-27
sp|P0CM76|CLP1_CRYNJ mRNA cleavage and polyadenylation factor CLP1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CLP1 PE=3 SV=1 20 352 2.0E-21
sp|P0CM77|CLP1_CRYNB mRNA cleavage and polyadenylation factor CLP1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CLP1 PE=3 SV=1 20 352 2.0E-21
sp|A8PWG8|CLP1_MALGO mRNA cleavage and polyadenylation factor CLP1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=CLP1 PE=3 SV=1 132 441 2.0E-14
sp|A1DE49|CLP1_NEOFI mRNA cleavage and polyadenylation factor clp1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=clp1 PE=3 SV=1 387 451 7.0E-12
sp|Q4WVA5|CLP1_ASPFU mRNA cleavage and polyadenylation factor clp1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=clp1 PE=3 SV=1 387 451 2.0E-11
sp|B0Y0Y6|CLP1_ASPFC mRNA cleavage and polyadenylation factor clp1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=clp1 PE=3 SV=1 387 451 2.0E-11
sp|Q0CEZ9|CLP1_ASPTN mRNA cleavage and polyadenylation factor clp1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=clp1 PE=3 SV=2 380 451 8.0E-11
sp|Q1DKL9|CLP1_COCIM mRNA cleavage and polyadenylation factor CLP1 OS=Coccidioides immitis (strain RS) GN=CLP1 PE=3 SV=2 387 451 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0031124 mRNA 3'-end processing Yes
GO:0043170 macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0006396 RNA processing No
GO:0008152 metabolic process No
GO:0031123 RNA 3'-end processing No
GO:0006397 mRNA processing No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016071 mRNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016070 RNA metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5461
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3639
Ophiocordyceps australis map64 (Brazil) OphauB2|5612
Ophiocordyceps camponoti-rufipedis Ophun1|2264 (this protein)
Ophiocordyceps kimflemingae Ophio5|7328
Ophiocordyceps subramaniannii Hirsu2|6291

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2264
MSIPGLGQIPAPSVASSTRTITLKTAWEWRFEVAAGRSIVVKILSGTAEKDGIELAPRGTYTFSGVKSKILTWHG
CELEVDGRCDDDFVAEYVAPADNPANAVLNLHVQLKEMRTVAARLGREGPRVLIAGPPNTGKTTMARTLASYATR
QGHQPIAVNVDPREAMLSLPGTLVAAVLATVLDPEAVDGWGSTPTSGPSSVPVKLPLVYMYGRASAEDDAELYKE
LVARLATAVSGRSTADADVRSSGIIVDTMRVSEKSKIGLDLISHVVDEFSINVVVVVGSTRMNAELSKRFATEKT
SLGEPIHVILLDRSEGVVERDEAFMDHSREQVIKEYFFGDARRALSPQIQQVDFDSLVVYRTPEYSIPGQESLVR
EEPSSVMEHWTLAVMHASVKDAPEMVRAASVMGFVYVSDVDEERRKMKILAPVGGRLGDRPLILGKWPEPYINLL
G*
Coding >Ophun1|2264
ATGTCGATTCCTGGCCTGGGACAGATTCCAGCTCCGTCCGTTGCTTCGTCTACACGAACCATCACCCTCAAAACA
GCATGGGAATGGCGGTTTGAAGTAGCCGCAGGACGATCGATCGTCGTCAAGATACTCTCTGGGACGGCAGAAAAG
GACGGAATCGAGCTCGCACCGCGCGGAACATATACCTTCTCTGGCGTCAAGTCCAAGATCCTCACTTGGCATGGC
TGCGAGCTCGAGGTCGACGGCCGATGCGACGATGACTTCGTGGCCGAGTACGTGGCTCCAGCGGACAACCCGGCC
AACGCTGTTCTCAACCTACACGTGCAACTCAAAGAGATGCGTACCGTCGCAGCTCGTCTCGGCCGTGAGGGCCCG
CGCGTGCTCATTGCCGGTCCCCCTAACACGGGCAAGACGACGATGGCTCGCACACTGGCCAGCTATGCCACCCGC
CAGGGCCATCAGCCTATCGCCGTCAATGTCGATCCGCGCGAGGCCATGCTGTCATTGCCAGGAACCCTGGTAGCC
GCCGTGCTCGCCACAGTTCTTGATCCCGAGGCGGTTGATGGCTGGGGTAGCACTCCGACGAGCGGGCCCAGCAGC
GTGCCTGTCAAGCTGCCGCTGGTGTACATGTATGGCCGTGCTTCGGCCGAGGATGATGCCGAACTTTACAAGGAG
CTGGTTGCTCGTCTCGCCACCGCCGTCAGTGGCCGTTCCACTGCCGACGCCGATGTCCGCAGCTCTGGAATCATC
GTCGATACCATGCGTGTCAGTGAGAAGAGCAAGATCGGACTCGACCTGATTTCTCACGTCGTCGACGAGTTCTCC
ATCAACGTCGTTGTTGTCGTCGGCTCGACTAGGATGAATGCCGAGCTCAGCAAGCGGTTTGCCACAGAAAAGACG
AGCCTTGGCGAGCCCATCCACGTCATCTTGCTTGATCGATCCGAGGGTGTTGTCGAACGCGACGAGGCTTTTATG
GATCACTCACGCGAGCAGGTCATCAAGGAGTACTTCTTCGGCGACGCGCGCAGGGCACTGAGTCCGCAGATCCAA
CAAGTCGACTTTGACAGTCTTGTCGTGTACAGGACGCCTGAATATTCGATTCCCGGACAGGAGAGCCTGGTTCGC
GAGGAGCCGAGTTCCGTCATGGAGCACTGGACGTTGGCCGTCATGCACGCCTCGGTCAAGGATGCGCCCGAGATG
GTACGCGCGGCCAGCGTCATGGGCTTCGTCTACGTGTCCGACGTGGACGAGGAACGGCGCAAGATGAAGATACTG
GCTCCCGTCGGCGGGCGGCTTGGCGACAGACCGCTCATCTTGGGGAAGTGGCCGGAGCCCTACATCAACCTGCTG
GGCTAG
Transcript >Ophun1|2264
ATGTCGATTCCTGGCCTGGGACAGATTCCAGCTCCGTCCGTTGCTTCGTCTACACGAACCATCACCCTCAAAACA
GCATGGGAATGGCGGTTTGAAGTAGCCGCAGGACGATCGATCGTCGTCAAGATACTCTCTGGGACGGCAGAAAAG
GACGGAATCGAGCTCGCACCGCGCGGAACATATACCTTCTCTGGCGTCAAGTCCAAGATCCTCACTTGGCATGGC
TGCGAGCTCGAGGTCGACGGCCGATGCGACGATGACTTCGTGGCCGAGTACGTGGCTCCAGCGGACAACCCGGCC
AACGCTGTTCTCAACCTACACGTGCAACTCAAAGAGATGCGTACCGTCGCAGCTCGTCTCGGCCGTGAGGGCCCG
CGCGTGCTCATTGCCGGTCCCCCTAACACGGGCAAGACGACGATGGCTCGCACACTGGCCAGCTATGCCACCCGC
CAGGGCCATCAGCCTATCGCCGTCAATGTCGATCCGCGCGAGGCCATGCTGTCATTGCCAGGAACCCTGGTAGCC
GCCGTGCTCGCCACAGTTCTTGATCCCGAGGCGGTTGATGGCTGGGGTAGCACTCCGACGAGCGGGCCCAGCAGC
GTGCCTGTCAAGCTGCCGCTGGTGTACATGTATGGCCGTGCTTCGGCCGAGGATGATGCCGAACTTTACAAGGAG
CTGGTTGCTCGTCTCGCCACCGCCGTCAGTGGCCGTTCCACTGCCGACGCCGATGTCCGCAGCTCTGGAATCATC
GTCGATACCATGCGTGTCAGTGAGAAGAGCAAGATCGGACTCGACCTGATTTCTCACGTCGTCGACGAGTTCTCC
ATCAACGTCGTTGTTGTCGTCGGCTCGACTAGGATGAATGCCGAGCTCAGCAAGCGGTTTGCCACAGAAAAGACG
AGCCTTGGCGAGCCCATCCACGTCATCTTGCTTGATCGATCCGAGGGTGTTGTCGAACGCGACGAGGCTTTTATG
GATCACTCACGCGAGCAGGTCATCAAGGAGTACTTCTTCGGCGACGCGCGCAGGGCACTGAGTCCGCAGATCCAA
CAAGTCGACTTTGACAGTCTTGTCGTGTACAGGACGCCTGAATATTCGATTCCCGGACAGGAGAGCCTGGTTCGC
GAGGAGCCGAGTTCCGTCATGGAGCACTGGACGTTGGCCGTCATGCACGCCTCGGTCAAGGATGCGCCCGAGATG
GTACGCGCGGCCAGCGTCATGGGCTTCGTCTACGTGTCCGACGTGGACGAGGAACGGCGCAAGATGAAGATACTG
GCTCCCGTCGGCGGGCGGCTTGGCGACAGACCGCTCATCTTGGGGAAGTGGCCGGAGCCCTACATCAACCTGCTG
GGCTAG
Gene >Ophun1|2264
ATGTCGATTCCTGGCCTGGGACAGATTCCAGCTCCGGTAAGTTCTCCTTTTGAATCCCCTACATCTTCTATCGGC
CAAGACTGACAGAGCTGATAGTCCGTTGCTTCGTCTACACGAACCATCACCCTCAAAACAGCATGGGAATGGCGG
TTTGAAGTAGCCGCAGGACGATCGATCGTCGTCAAGATACTCTCTGGGACGGCAGAAAAGGACGGAATCGAGCTC
GCACCGCGCGGAACATATACCTTCTCTGGCGTCAAGTCCAAGATCCTCACTTGGCATGGCTGCGAGCTCGAGGTC
GACGGCCGATGCGACGATGACTTCGTGGCCGAGTACGTGGCTCCAGCGGACAACCCGGCCAACGCTGTTCTCAAC
CTACACGTGCAACTCAAAGAGATGCGTACCGTCGCAGCTCGTCTCGGCCGTGAGGGCCCGCGCGTGCTCATTGCC
GGTCCCCCTAACACGGGCAAGACGACGATGGCTCGCACACTGGCCAGCTATGCCACCCGCCAGGGCCATCAGCCT
ATCGCCGTCAATGTCGATCCGCGCGAGGCCATGCTGTCATTGCCAGGAACCCTGGTAGCCGCCGTGCTCGCCACA
GTTCTTGATCCCGAGGCGGTTGATGGCTGGGGTAGCACTCCGACGAGCGGGCCCAGCAGCGTGCCTGTCAAGCTG
CCGCTGGTGTACATGTATGGCCGTGCTTCGGCCGAGGATGATGCCGAACTTTACAAGGAGCTGGTTGCTCGTCTC
GCCACCGCCGTCAGTGGCCGTTCCACTGCCGACGCCGATGTCCGCAGCTCTGGAATCATCGTCGATACCATGCGT
GTCAGTGAGAAGAGCAAGATCGGACTCGACCTGATTTCTCACGTCGTCGACGAGTTCTCCAGTAGGTGACACGAC
TCCTCTATCTGGACTGGCTGACGCGTCCGCAGTCAACGTCGTTGTTGTCGTCGGCTCGACTAGGATGAATGCCGA
GCTCAGCAAGCGGTTTGCCACAGAAAAGACGAGCCTTGGCGAGCCCATCCACGTCATCTTGCTTGATCGATCCGA
GGGTGTTGTCGAACGCGACGAGGCTTTTATGGATCACTCACGCGAGCAGGTCATCAAGGAGTACTTCTTCGGCGA
CGCGCGCAGGGCACTGAGTCCGCAGATCCAACAAGTCGACTTTGACAGTCTTGTCGTGTACAGGACGCCTGAATG
TACGTCCGCGTCCGATCTCGGAGTCTCGGTTGCTGACACGCATTAGATTCGATTCCCGGACAGGAGAGCCTGGTT
CGCGAGGAGCCGAGTTCCGTCATGGAGCACTGGACGTTGGCCGTCATGCACGCCTCGGTCAAGGATGCGCCCGAG
ATGGTACGCGCGGCCAGCGTCATGGGCTTCGTCTACGTGTCCGACGTGGACGAGGAACGGCGCAAGATGAAGATA
CTGGCTCCCGTCGGCGGGCGGCTTGGCGACAGACCGCTCATCTTGGGGAAGTGGCCGGAGCCCTACATCAACCTG
CTGGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail