Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2260
Gene name
LocationContig_209:2392..3791
Strand-
Gene length (bp)1399
Transcript length (bp)1302
Coding sequence length (bp)1302
Protein length (aa) 434

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11710 Git3 G protein-coupled glucose receptor regulating Gpa2 7.0E-33 31 190
PF11970 GPR_Gpa2_C G protein-coupled glucose receptor regulating Gpa2 C-term 5.2E-17 281 351

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12361|GPR1_YEAST G protein-coupled receptor GPR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPR1 PE=1 SV=1 25 193 9.0E-14
sp|O94744|GIT3_SCHPO Glucose receptor protein git3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=git3 PE=3 SV=1 43 309 5.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.5

Transmembrane Domains

Domain # Start End Length
1 15 33 18
2 40 62 22
3 77 99 22
4 120 142 22
5 162 184 22
6 292 314 22
7 324 346 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2260
MPVPGPGPLTISLQGHKLAINVTCLILASLSVVATAWAKTLIVILLQIDLFKSAILVLVPAIELVHGPVISGSTT
CHVIGCVLLITLEACNVAIVLLALHTALNVFRGEGGLYPHRRLAWAVGIVLSLALAFLAFINRPAFVNTGGFCHV
PERPRWPKRVLIWLPRGVCLVIIVFTYVATFVYVQKLMRRFVAGPVQPGPRSKIAEPTPPPSLASLRLSPWQPDM
MPPRDSGLRPVLTLASASGPSCPAVSGSHPSLLVRPDSSTTVMLSPTTFGASGMAETRDKVRRQLRLLFIYPMVY
MGLWTVPLICHIMSLLDRGETLGLSLASIASLSLQGVADALVFLVVEKPWRQPRHGGGASCWLVHAIQGTTVTTT
TNAGRSRDEMRFDSRVARRRREGERVAERRSKRSPSRVREWWDVRVETDVDDDGYGDT*
Coding >Ophun1|2260
ATGCCCGTCCCAGGCCCTGGCCCCCTGACCATCAGCCTACAAGGCCACAAGCTGGCCATCAACGTAACATGCCTC
ATCCTCGCAAGCCTAAGCGTCGTCGCCACCGCGTGGGCCAAGACCCTCATCGTCATCCTCCTCCAAATCGACCTC
TTCAAATCAGCCATCCTCGTCCTCGTCCCCGCAATCGAACTCGTCCACGGTCCCGTCATCTCAGGCTCGACAACA
TGTCACGTCATCGGCTGCGTCCTCCTCATCACGCTGGAAGCCTGCAACGTCGCCATCGTCCTTCTAGCCCTGCAC
ACGGCCCTCAACGTATTCCGAGGCGAAGGGGGACTCTACCCGCATCGACGTCTGGCTTGGGCCGTCGGCATCGTG
CTATCTCTGGCTCTCGCTTTCCTCGCCTTCATCAATAGGCCTGCCTTTGTCAATACCGGTGGCTTCTGTCATGTT
CCTGAGAGGCCGAGGTGGCCTAAGCGGGTGCTGATATGGCTCCCTCGCGGCGTGTGTCTCGTCATCATCGTCTTC
ACTTACGTTGCCACCTTTGTATACGTTCAGAAGCTCATGAGGCGCTTCGTCGCTGGTCCTGTGCAGCCTGGACCT
CGCAGCAAGATAGCGGAACCGACTCCGCCGCCCTCGCTGGCTTCGCTCCGTCTCTCTCCGTGGCAGCCGGACATG
ATGCCGCCCCGAGACTCGGGCCTCCGGCCGGTGCTGACGCTGGCATCCGCATCGGGACCGTCGTGTCCGGCCGTG
TCGGGCTCTCATCCGTCGCTGCTGGTCCGACCAGACTCGTCGACAACCGTCATGCTCTCCCCAACGACATTCGGC
GCCTCAGGAATGGCCGAGACGCGAGACAAGGTCCGCCGTCAGCTGCGTCTGCTCTTCATCTACCCCATGGTTTAC
ATGGGCTTGTGGACCGTCCCCCTGATATGCCACATCATGAGCCTCCTCGACCGCGGCGAAACCCTCGGCCTCAGT
CTAGCCAGCATCGCCAGTCTGAGCCTGCAGGGTGTCGCCGACGCTCTCGTCTTCCTCGTCGTGGAGAAGCCGTGG
CGTCAACCGCGGCATGGCGGCGGCGCCTCTTGCTGGCTCGTTCACGCCATACAGGGCACCACGGTGACGACAACC
ACCAACGCTGGCCGCAGTCGCGACGAGATGCGCTTCGACAGCCGCGTCGCGAGACGTCGTCGAGAAGGAGAGCGC
GTTGCCGAGCGCCGTTCCAAGCGCAGTCCCAGCCGCGTGCGCGAGTGGTGGGACGTTCGTGTCGAGACGGATGTG
GACGACGACGGCTACGGCGACACGTGA
Transcript >Ophun1|2260
ATGCCCGTCCCAGGCCCTGGCCCCCTGACCATCAGCCTACAAGGCCACAAGCTGGCCATCAACGTAACATGCCTC
ATCCTCGCAAGCCTAAGCGTCGTCGCCACCGCGTGGGCCAAGACCCTCATCGTCATCCTCCTCCAAATCGACCTC
TTCAAATCAGCCATCCTCGTCCTCGTCCCCGCAATCGAACTCGTCCACGGTCCCGTCATCTCAGGCTCGACAACA
TGTCACGTCATCGGCTGCGTCCTCCTCATCACGCTGGAAGCCTGCAACGTCGCCATCGTCCTTCTAGCCCTGCAC
ACGGCCCTCAACGTATTCCGAGGCGAAGGGGGACTCTACCCGCATCGACGTCTGGCTTGGGCCGTCGGCATCGTG
CTATCTCTGGCTCTCGCTTTCCTCGCCTTCATCAATAGGCCTGCCTTTGTCAATACCGGTGGCTTCTGTCATGTT
CCTGAGAGGCCGAGGTGGCCTAAGCGGGTGCTGATATGGCTCCCTCGCGGCGTGTGTCTCGTCATCATCGTCTTC
ACTTACGTTGCCACCTTTGTATACGTTCAGAAGCTCATGAGGCGCTTCGTCGCTGGTCCTGTGCAGCCTGGACCT
CGCAGCAAGATAGCGGAACCGACTCCGCCGCCCTCGCTGGCTTCGCTCCGTCTCTCTCCGTGGCAGCCGGACATG
ATGCCGCCCCGAGACTCGGGCCTCCGGCCGGTGCTGACGCTGGCATCCGCATCGGGACCGTCGTGTCCGGCCGTG
TCGGGCTCTCATCCGTCGCTGCTGGTCCGACCAGACTCGTCGACAACCGTCATGCTCTCCCCAACGACATTCGGC
GCCTCAGGAATGGCCGAGACGCGAGACAAGGTCCGCCGTCAGCTGCGTCTGCTCTTCATCTACCCCATGGTTTAC
ATGGGCTTGTGGACCGTCCCCCTGATATGCCACATCATGAGCCTCCTCGACCGCGGCGAAACCCTCGGCCTCAGT
CTAGCCAGCATCGCCAGTCTGAGCCTGCAGGGTGTCGCCGACGCTCTCGTCTTCCTCGTCGTGGAGAAGCCGTGG
CGTCAACCGCGGCATGGCGGCGGCGCCTCTTGCTGGCTCGTTCACGCCATACAGGGCACCACGGTGACGACAACC
ACCAACGCTGGCCGCAGTCGCGACGAGATGCGCTTCGACAGCCGCGTCGCGAGACGTCGTCGAGAAGGAGAGCGC
GTTGCCGAGCGCCGTTCCAAGCGCAGTCCCAGCCGCGTGCGCGAGTGGTGGGACGTTCGTGTCGAGACGGATGTG
GACGACGACGGCTACGGCGACACGTGA
Gene >Ophun1|2260
ATGCCCGTCCCAGGCCCTGGCCCCCTGACCATCAGCCTACAAGGCCACAAGCTGGCCATCAACGTAACATGCCTC
ATCCTCGCAAGCCTAAGCGTCGTCGCCACCGCGTGGGCCAAGACGTGCTTCCTCCGCGTACAGAAGAACTTTCGC
CACGAGCGCGTTGCCCCCCTTCCTCTTCTCCTTAGAACTCGACGTCTCCGGCTAACAAAGAAACAGCCTCATCGT
CATCCTCCTCCAAATCGACCTCTTCAAATCAGCCATCCTCGTCCTCGTCCCCGCAATCGAACTCGTCCACGGTCC
CGTCATCTCAGGCTCGACAACATGTCACGTCATCGGCTGCGTCCTCCTCATCACGCTGGAAGCCTGCAACGTCGC
CATCGTCCTTCTAGCCCTGCACACGGCCCTCAACGTATTCCGAGGCGAAGGGGGACTCTACCCGCATCGACGTCT
GGCTTGGGCCGTCGGCATCGTGCTATCTCTGGCTCTCGCTTTCCTCGCCTTCATCAATAGGCCTGCCTTTGTCAA
TACCGGTGGCTTCTGTCATGTTCCTGAGAGGCCGAGGTGGCCTAAGCGGGTGCTGATATGGCTCCCTCGCGGCGT
GTGTCTCGTCATCATCGTCTTCACTTACGTTGCCACCTTTGTATACGTTCAGAAGCTCATGAGGCGCTTCGTCGC
TGGTCCTGTGCAGCCTGGACCTCGCAGCAAGATAGCGGAACCGACTCCGCCGCCCTCGCTGGCTTCGCTCCGTCT
CTCTCCGTGGCAGCCGGACATGATGCCGCCCCGAGACTCGGGCCTCCGGCCGGTGCTGACGCTGGCATCCGCATC
GGGACCGTCGTGTCCGGCCGTGTCGGGCTCTCATCCGTCGCTGCTGGTCCGACCAGACTCGTCGACAACCGTCAT
GCTCTCCCCAACGACATTCGGCGCCTCAGGAATGGCCGAGACGCGAGACAAGGTCCGCCGTCAGCTGCGTCTGCT
CTTCATCTACCCCATGGTTTACATGGGCTTGTGGACCGTCCCCCTGATATGCCACATCATGAGCCTCCTCGACCG
CGGCGAAACCCTCGGCCTCAGTCTAGCCAGCATCGCCAGTCTGAGCCTGCAGGGTGTCGCCGACGCTCTCGTCTT
CCTCGTCGTGGAGAAGCCGTGGCGTCAACCGCGGCATGGCGGCGGCGCCTCTTGCTGGCTCGTTCACGCCATACA
GGGCACCACGGTGACGACAACCACCAACGCTGGCCGCAGTCGCGACGAGATGCGCTTCGACAGCCGCGTCGCGAG
ACGTCGTCGAGAAGGAGAGCGCGTTGCCGAGCGCCGTTCCAAGCGCAGTCCCAGCCGCGTGCGCGAGTGGTGGGA
CGTTCGTGTCGAGACGGATGTGGACGACGACGGCTACGGCGACACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail