Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2255
Gene name
LocationContig_208:22696..24618
Strand+
Gene length (bp)1922
Transcript length (bp)1566
Coding sequence length (bp)1566
Protein length (aa) 522

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01591 6PF2K 6-phosphofructo-2-kinase 1.6E-28 44 169
PF01591 6PF2K 6-phosphofructo-2-kinase 2.7E-10 170 237
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 1.8E-21 243 430

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06137|YL345_YEAST Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase YLR345W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR345W PE=1 SV=1 24 445 6.0E-98
sp|P16118|F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens GN=PFKFB1 PE=1 SV=3 50 444 7.0E-67
sp|Q16877|F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens GN=PFKFB4 PE=2 SV=6 41 444 6.0E-66
sp|O60825|F262_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens GN=PFKFB2 PE=1 SV=2 57 444 7.0E-66
sp|Q4R8B6|F264_MACFA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Macaca fascicularis GN=PFKFB4 PE=2 SV=3 41 444 9.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06137|YL345_YEAST Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase YLR345W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR345W PE=1 SV=1 24 445 6.0E-98
sp|P16118|F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens GN=PFKFB1 PE=1 SV=3 50 444 7.0E-67
sp|Q16877|F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens GN=PFKFB4 PE=2 SV=6 41 444 6.0E-66
sp|O60825|F262_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens GN=PFKFB2 PE=1 SV=2 57 444 7.0E-66
sp|Q4R8B6|F264_MACFA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Macaca fascicularis GN=PFKFB4 PE=2 SV=3 41 444 9.0E-66
sp|P49872|F261_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Bos taurus GN=PFKFB1 PE=2 SV=1 50 444 1.0E-65
sp|P32604|F26_YEAST Fructose-2,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FBP26 PE=1 SV=2 42 455 2.0E-65
sp|O35552|F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus GN=Pfkfb3 PE=2 SV=1 56 444 2.0E-65
sp|Q5NVT1|F262_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Pongo abelii GN=PFKFB2 PE=2 SV=1 57 444 3.0E-65
sp|P70265|F262_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Mus musculus GN=Pfkfb2 PE=1 SV=2 57 444 4.0E-65
sp|Q9JJH5|F262_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Rattus norvegicus GN=Pfkfb2 PE=1 SV=1 57 444 7.0E-65
sp|P26285|F262_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Bos taurus GN=PFKFB2 PE=1 SV=2 57 444 7.0E-65
sp|P07953|F261_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus GN=Pfkfb1 PE=1 SV=3 50 444 1.0E-64
sp|Q16875|F263_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens GN=PFKFB3 PE=1 SV=1 56 444 1.0E-64
sp|Q5R9C1|F263_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Pongo abelii GN=PFKFB3 PE=2 SV=2 56 444 2.0E-64
sp|P70266|F261_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Mus musculus GN=Pfkfb1 PE=1 SV=2 50 444 2.0E-64
sp|P25114|F264_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus GN=Pfkfb4 PE=1 SV=3 41 444 3.0E-64
sp|Q6DTY7|F264_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Mus musculus GN=Pfkfb4 PE=2 SV=4 41 444 4.0E-64
sp|Q91348|F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus PE=2 SV=2 50 444 4.0E-63
sp|Q91309|F26_LITCT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Lithobates catesbeiana PE=2 SV=1 50 444 6.0E-63
sp|Q28901|F263_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (Fragment) OS=Bos taurus GN=PFKFB3 PE=2 SV=2 56 444 3.0E-61
sp|Q21122|F2612_CAEEL 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Caenorhabditis elegans GN=pfkb-1.2 PE=3 SV=2 57 439 8.0E-60
sp|Q9MB58|F26_ARATH 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Arabidopsis thaliana GN=FKFBP PE=1 SV=1 55 430 8.0E-58
sp|Q8TFH0|YIKE_SCHPO Probable 6-phosphofructo-2-kinase PB17E12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.14c PE=1 SV=2 54 435 5.0E-49
sp|Q9UTK9|YIVH_SCHPO Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase C144.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.17c PE=1 SV=2 30 434 7.0E-49
sp|Q9URZ7|YK72_SCHPO Probable fructose-2,6-bisphosphatase C732.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC732.02c PE=3 SV=1 55 445 7.0E-45
sp|P40433|6P21_YEAST 6-phosphofructo-2-kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFK26 PE=1 SV=1 54 435 7.0E-44
sp|Q9UTE1|YFMD_SCHPO Probable 6-phosphofructo-2-kinase C222.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC222.13c PE=3 SV=1 54 411 9.0E-44
[Show less]

GO

GO Term Description Terminal node
GO:0006000 fructose metabolic process Yes
GO:0005524 ATP binding Yes
GO:0003873 6-phosphofructo-2-kinase activity Yes
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0030554 adenyl nucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0019318 hexose metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0008152 metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0005996 monosaccharide metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0019200 carbohydrate kinase activity No
GO:0008443 phosphofructokinase activity No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0005975 carbohydrate metabolic process No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3659
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2693
Ophiocordyceps australis map64 (Brazil) OphauB2|3534
Ophiocordyceps camponoti-floridani Ophcf2|00640
Ophiocordyceps camponoti-rufipedis Ophun1|2255 (this protein)
Ophiocordyceps kimflemingae Ophio5|5184
Ophiocordyceps subramaniannii Hirsu2|7072

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2255
MDTLLTAKIAANAPRYRRRSSTFLDGIHDVIEDQDMAPAQLYSTMSGRLFHSGRIAIVMVGPPARGKTHICVSLA
RYLQWLGVKTRIFHLGDYRRATVGPEGSVPEDYFFPNASPSSAMLRQKILKKCREDIYAWLNHENGQVAIYDAVN
PTASGRRSLAKELGKHDVQFAGMDPDEAAQLYLKRIEMRIPMFETMSEAELNYIKMINAGAKFFYNNVSFNYLSH
RIVFYLTNLHIKSRKTFFVRAGTTEVEDSYKADAPLSEQGKVYAEKMSKTLLKHREQEQAEQAGKGGMQTPLRPL
TVWTSTRRRTVQTADYLGEQGYKVRQRSQMSQINPGVCEKMTERIIRQIYPEEVEKHGLDPYHHRYPRAESYHDL
AVRLEPIILELEREQNDLLIIAHESVLRVLYAYLMHCSTMQIPCLKFPRDEIIEIIPAAYQNEAKRIHIPGLDPR
LPPGSPDDITVPLRMMTASGRDSRSASLPSSGQMSPIAGGMGSPALAVERPPEKVINTAKDMVADKVDDED*
Coding >Ophun1|2255
ATGGACACGCTCTTAACTGCCAAGATAGCGGCCAACGCTCCCCGATATCGTCGCAGGAGCTCGACCTTCCTCGAT
GGCATCCACGACGTCATCGAGGACCAGGACATGGCCCCTGCCCAGCTGTACAGCACCATGTCCGGTCGACTTTTT
CACTCGGGACGCATCGCTATCGTCATGGTCGGTCCACCGGCACGAGGCAAGACTCACATCTGCGTCTCACTAGCC
AGGTATCTGCAATGGTTGGGCGTCAAGACTCGCATCTTTCACCTGGGTGACTATCGACGCGCCACTGTCGGCCCC
GAAGGCTCCGTTCCCGAGGACTATTTCTTCCCCAACGCCTCTCCGTCCTCTGCTATGCTGCGGCAAAAGATATTG
AAGAAGTGCCGGGAAGACATCTACGCCTGGCTGAACCACGAAAACGGCCAGGTCGCCATATACGACGCAGTCAAC
CCCACGGCGAGCGGACGGCGGTCTCTGGCTAAAGAGTTGGGCAAGCACGACGTTCAGTTTGCTGGGATGGACCCC
GACGAGGCAGCCCAGTTGTATTTAAAACGGATCGAAATGCGGATCCCCATGTTCGAGACGATGAGCGAGGCCGAA
CTCAACTACATCAAGATGATCAACGCCGGGGCCAAGTTCTTCTACAACAACGTCAGCTTCAATTACCTCTCGCAC
CGCATCGTCTTTTACCTCACCAACTTGCACATCAAGTCGCGAAAGACGTTTTTCGTTCGAGCCGGCACGACCGAG
GTGGAGGACTCGTACAAGGCCGACGCGCCGCTTTCGGAGCAAGGCAAAGTATACGCAGAGAAGATGTCCAAGACG
CTGTTGAAGCATCGCGAGCAGGAGCAGGCGGAGCAGGCGGGAAAGGGCGGGATGCAAACACCCCTGAGACCGTTG
ACGGTCTGGACGTCGACCCGACGTCGGACGGTGCAGACAGCAGACTACCTCGGGGAGCAGGGCTACAAAGTCCGG
CAGCGATCCCAGATGAGCCAGATCAACCCCGGCGTGTGCGAAAAGATGACGGAGCGCATAATCCGGCAGATATAC
CCTGAGGAGGTGGAGAAGCACGGGTTGGATCCCTATCATCATAGATATCCCCGCGCAGAGTCCTACCATGACCTG
GCGGTGCGTCTTGAGCCCATCATCCTGGAGCTCGAGCGGGAGCAAAACGACCTGCTCATCATTGCGCACGAATCG
GTGCTCCGCGTCTTGTACGCGTACTTGATGCACTGCTCGACGATGCAGATTCCCTGCCTCAAGTTCCCCCGCGAC
GAGATCATCGAGATCATCCCGGCAGCGTACCAGAACGAGGCCAAGCGGATCCACATCCCCGGCCTCGACCCGAGA
CTCCCTCCGGGCTCCCCCGACGACATCACGGTGCCCCTCAGGATGATGACGGCAAGCGGCAGGGACAGCAGGTCG
GCGAGCTTGCCCAGCAGCGGCCAGATGAGTCCCATCGCCGGCGGCATGGGCAGCCCGGCGCTGGCGGTTGAACGG
CCGCCGGAAAAGGTGATTAACACGGCCAAGGACATGGTCGCGGACAAGGTCGACGACGAGGATTAG
Transcript >Ophun1|2255
ATGGACACGCTCTTAACTGCCAAGATAGCGGCCAACGCTCCCCGATATCGTCGCAGGAGCTCGACCTTCCTCGAT
GGCATCCACGACGTCATCGAGGACCAGGACATGGCCCCTGCCCAGCTGTACAGCACCATGTCCGGTCGACTTTTT
CACTCGGGACGCATCGCTATCGTCATGGTCGGTCCACCGGCACGAGGCAAGACTCACATCTGCGTCTCACTAGCC
AGGTATCTGCAATGGTTGGGCGTCAAGACTCGCATCTTTCACCTGGGTGACTATCGACGCGCCACTGTCGGCCCC
GAAGGCTCCGTTCCCGAGGACTATTTCTTCCCCAACGCCTCTCCGTCCTCTGCTATGCTGCGGCAAAAGATATTG
AAGAAGTGCCGGGAAGACATCTACGCCTGGCTGAACCACGAAAACGGCCAGGTCGCCATATACGACGCAGTCAAC
CCCACGGCGAGCGGACGGCGGTCTCTGGCTAAAGAGTTGGGCAAGCACGACGTTCAGTTTGCTGGGATGGACCCC
GACGAGGCAGCCCAGTTGTATTTAAAACGGATCGAAATGCGGATCCCCATGTTCGAGACGATGAGCGAGGCCGAA
CTCAACTACATCAAGATGATCAACGCCGGGGCCAAGTTCTTCTACAACAACGTCAGCTTCAATTACCTCTCGCAC
CGCATCGTCTTTTACCTCACCAACTTGCACATCAAGTCGCGAAAGACGTTTTTCGTTCGAGCCGGCACGACCGAG
GTGGAGGACTCGTACAAGGCCGACGCGCCGCTTTCGGAGCAAGGCAAAGTATACGCAGAGAAGATGTCCAAGACG
CTGTTGAAGCATCGCGAGCAGGAGCAGGCGGAGCAGGCGGGAAAGGGCGGGATGCAAACACCCCTGAGACCGTTG
ACGGTCTGGACGTCGACCCGACGTCGGACGGTGCAGACAGCAGACTACCTCGGGGAGCAGGGCTACAAAGTCCGG
CAGCGATCCCAGATGAGCCAGATCAACCCCGGCGTGTGCGAAAAGATGACGGAGCGCATAATCCGGCAGATATAC
CCTGAGGAGGTGGAGAAGCACGGGTTGGATCCCTATCATCATAGATATCCCCGCGCAGAGTCCTACCATGACCTG
GCGGTGCGTCTTGAGCCCATCATCCTGGAGCTCGAGCGGGAGCAAAACGACCTGCTCATCATTGCGCACGAATCG
GTGCTCCGCGTCTTGTACGCGTACTTGATGCACTGCTCGACGATGCAGATTCCCTGCCTCAAGTTCCCCCGCGAC
GAGATCATCGAGATCATCCCGGCAGCGTACCAGAACGAGGCCAAGCGGATCCACATCCCCGGCCTCGACCCGAGA
CTCCCTCCGGGCTCCCCCGACGACATCACGGTGCCCCTCAGGATGATGACGGCAAGCGGCAGGGACAGCAGGTCG
GCGAGCTTGCCCAGCAGCGGCCAGATGAGTCCCATCGCCGGCGGCATGGGCAGCCCGGCGCTGGCGGTTGAACGG
CCGCCGGAAAAGGTGATTAACACGGCCAAGGACATGGTCGCGGACAAGGTCGACGACGAGGATTAG
Gene >Ophun1|2255
ATGGACACGCTCTTGTGGGTATACTCGGCGTCACCCGAGGCGTGCCCGACACTGACGTCAACAGAACTGCCAAGA
TAGCGGCCAACGCTCCCCGATATCGTCGCAGGAGCTCGACCTTCCTCGATGGCATCCACGACGTCATCGAGGACC
AGGACATGGCCCCTGCCCAGCTGTACAGCACCATGTCCGGTCGACTTTTTCACTCGGGACGCATCGCTATCGTCA
TGGTCGGTCCACCGGCACGAGGCAAGACGTGAGCTAGAATTGTCTCAGCCTTGGTTGTGTCATTTCTCATCCCTT
TCTAGTCACATCTGCGTCTCACTAGCCAGGTATCTGCAATGGTTGGGCGTCAAGACTCGCATCTTTCACCTGGGT
GACTATCGACGCGCCACTGTCGGCCCCGAAGGCTCCGTTCCCGAGGACTATTTCTTCCCCAACGCCTCTCCGTCC
TCTGCTATGCTGCGGCAAAAGATATTGAAGAAGTGCCGGGAAGACATCTACGCCTGGCTGAACCACGAAAACGGC
CAGGTCGCCATATACGACGCAGTCAACCCCACGGCGAGCGGACGGCGGTCTCTGGCTAAAGAGTTGGGCAAGCAC
GACGTTCAGGTGAGTGTGTCATGGATCCTCACACAAAAGGACAGCAGATGGTTGACATAGAAAGACTCTCTTCAT
CGAGTCGTACGTGGATGACGAACGCATCCTACGAGAGAATGCAAGAAACGTCAAAATATCATCTCCTGATGTGAG
CTTAGACTTGTTCATGCCACTTTCCCGGATCACTACTTACTCAGAGTCAAGTTTGCTGGGATGGACCCCGACGAG
GCAGCCCAGTTGTATTTAAAACGGATCGAAATGCGGATCCCCATGTTCGAGACGATGAGCGAGGCCGAACTCAAC
TACATCAAGATGATCAACGCCGGGGCCAAGTTCTTCTACAACAACGTCAGCTTCAATTACCTCTCGCACCGCATC
GTCTTTTACCTCACCAACTTGCACATCAAGTCGCGAAAGACGTTTTTCGTTCGAGCCGGCACGACCGAGGTGGAG
GACTCGTACAAGGCCGACGCGCCGCTTTCGGAGCAAGGCAAAGTATACGCAGAGAAGATGTCCAAGACGCTGTTG
AAGCATCGCGAGCAGGAGCAGGCGGAGCAGGCGGGAAAGGGCGGGATGCAAACACCCCTGAGACCGTTGACGGTC
TGGACGTCGACCCGACGTCGGACGGTGCAGACAGCAGACTACCTCGGGGAGCAGGGCTACAAAGTCCGGCAGCGA
TCCCAGATGAGCCAGATCAACCCCGGCGTGTGCGAAAAGATGACGGAGCGCATAATCCGGCAGATATACCCTGAG
GAGGTGGAGAAGCACGGGTTGGATCCCTATCATCATAGATATCCCCGCGCAGAGGTACGTCGGCGACCGGGATCG
GAGCTTACTGCATCCCTGACTACTGACGAGGTGGCCATCAGTCCTACCATGACCTGGCGGTGCGTCTTGAGCCCA
TCATCCTGGAGCTCGAGCGGGAGCAAAACGACCTGCTCATCATTGCGCACGAATCGGTGCTCCGCGTCTTGTACG
CGTACTTGATGCACTGCTCGACGATGCAGATTCCCTGCCTCAAGTTCCCCCGCGACGAGATCATCGAGATCATCC
CGGCAGCGTACCAGAACGAGGCCAAGCGGATCCACATCCCCGGCCTCGACCCGAGACTCCCTCCGGGCTCCCCCG
ACGACATCACGGTGCCCCTCAGGATGATGACGGCAAGCGGCAGGGACAGCAGGTCGGCGAGCTTGCCCAGCAGCG
GCCAGATGAGTCCCATCGCCGGCGGCATGGGCAGCCCGGCGCTGGCGGTTGAACGGCCGCCGGAAAAGGTGATTA
ACACGGCCAAGGACATGGTCGCGGACAAGGTCGACGACGAGGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail