Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2254
Gene name
LocationContig_208:20707..21900
Strand-
Gene length (bp)1193
Transcript length (bp)1131
Coding sequence length (bp)1131
Protein length (aa) 377

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01459 Porin_3 Eukaryotic porin 2.5E-82 40 327

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P24391|TOM40_NEUCR Mitochondrial import receptor subunit tom40 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tom40 PE=1 SV=1 1 376 3.0E-154
sp|P23644|TOM40_YEAST Mitochondrial import receptor subunit TOM40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM40 PE=1 SV=1 15 321 6.0E-91
sp|O13656|TOM40_SCHPO Probable mitochondrial import receptor subunit tom40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tom40 PE=3 SV=3 6 352 4.0E-87
sp|Q9U4L6|TO401_DROME Mitochondrial import receptor subunit TOM40 homolog 1 OS=Drosophila melanogaster GN=Tom40 PE=2 SV=2 38 321 2.0E-26
sp|Q9LHE5|TO401_ARATH Mitochondrial import receptor subunit TOM40-1 OS=Arabidopsis thaliana GN=TOM40-1 PE=1 SV=3 17 321 2.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P24391|TOM40_NEUCR Mitochondrial import receptor subunit tom40 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tom40 PE=1 SV=1 1 376 3.0E-154
sp|P23644|TOM40_YEAST Mitochondrial import receptor subunit TOM40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM40 PE=1 SV=1 15 321 6.0E-91
sp|O13656|TOM40_SCHPO Probable mitochondrial import receptor subunit tom40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tom40 PE=3 SV=3 6 352 4.0E-87
sp|Q9U4L6|TO401_DROME Mitochondrial import receptor subunit TOM40 homolog 1 OS=Drosophila melanogaster GN=Tom40 PE=2 SV=2 38 321 2.0E-26
sp|Q9LHE5|TO401_ARATH Mitochondrial import receptor subunit TOM40-1 OS=Arabidopsis thaliana GN=TOM40-1 PE=1 SV=3 17 321 2.0E-24
sp|Q7ZTM6|TOM40_XENLA Mitochondrial import receptor subunit TOM40 homolog OS=Xenopus laevis GN=tomm40 PE=2 SV=1 38 324 9.0E-24
sp|Q6P825|TOM40_XENTR Mitochondrial import receptor subunit TOM40 homolog OS=Xenopus tropicalis GN=tomm40 PE=2 SV=1 38 324 5.0E-23
sp|A1Z6L1|TO402_DROME Mitochondrial import receptor subunit TOM40 homolog 2 OS=Drosophila melanogaster GN=tomboy40 PE=2 SV=1 38 307 4.0E-21
sp|Q969M1|TM40L_HUMAN Mitochondrial import receptor subunit TOM40B OS=Homo sapiens GN=TOMM40L PE=1 SV=1 33 324 4.0E-20
sp|O96008|TOM40_HUMAN Mitochondrial import receptor subunit TOM40 homolog OS=Homo sapiens GN=TOMM40 PE=1 SV=1 38 252 5.0E-20
sp|Q1LZB5|TOM40_BOVIN Mitochondrial import receptor subunit TOM40 homolog OS=Bos taurus GN=TOMM40 PE=2 SV=1 38 252 5.0E-20
sp|A6QR22|TM40L_BOVIN Mitochondrial import receptor subunit TOM40B OS=Bos taurus GN=TOMM40L PE=2 SV=1 14 324 5.0E-20
sp|Q9QYA2|TOM40_MOUSE Mitochondrial import receptor subunit TOM40 homolog OS=Mus musculus GN=Tomm40 PE=1 SV=3 38 252 1.0E-19
sp|Q75Q40|TOM40_RAT Mitochondrial import receptor subunit TOM40 homolog OS=Rattus norvegicus GN=Tomm40 PE=1 SV=1 38 252 2.0E-19
sp|Q9SX55|TO402_ARATH Probable mitochondrial import receptor subunit TOM40-2 OS=Arabidopsis thaliana GN=TOM40-2 PE=1 SV=3 14 321 7.0E-19
sp|A4F267|TM40L_RAT Mitochondrial import receptor subunit TOM40B OS=Rattus norvegicus GN=Tomm40l PE=1 SV=1 14 324 1.0E-18
sp|Q9CZR3|TM40L_MOUSE Mitochondrial import receptor subunit TOM40B OS=Mus musculus GN=Tomm40l PE=1 SV=1 32 324 2.0E-18
sp|Q61Z83|TOM40_CAEBR Mitochondrial import receptor subunit TOM40 homolog OS=Caenorhabditis briggsae GN=CBG03225 PE=3 SV=1 30 321 3.0E-15
sp|Q18090|TOM40_CAEEL Mitochondrial import receptor subunit TOM40 homolog OS=Caenorhabditis elegans GN=C18E9.6 PE=3 SV=1 39 321 1.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0005741 mitochondrial outer membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0031966 mitochondrial membrane No
GO:0051234 establishment of localization No
GO:0031090 organelle membrane No
GO:0031968 organelle outer membrane No
GO:0016020 membrane No
GO:0019867 outer membrane No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0098588 bounding membrane of organelle No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3660
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2694
Ophiocordyceps australis map64 (Brazil) OphauB2|3533
Ophiocordyceps camponoti-floridani Ophcf2|00639
Ophiocordyceps camponoti-rufipedis Ophun1|2254 (this protein)
Ophiocordyceps kimflemingae Ophio5|5183
Ophiocordyceps subramaniannii Hirsu2|7073

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2254
MTTSTIDSIRSLVLSNPLAITIGDAINSFAERRAKLGLSNPGSIESLTKEVQRDVLLGSLMFTGVRADLTKIFSM
APLFQVSHQFAMSGERINPYTFAAMYGTGKVFLQGNLDNEGSLSGRFNYRWTDKLVSKTNVSVSPGGQDMAQFEH
EYTGNDFTANLKVLNPSFWDGGVTGICIGSYLQSLTPRLALGLETLWQRPSLAQGPECAVSYCARYKASDWIATA
QLQAAMGTLNTSYWRRLSDKVQAGVDLTLGIVPIPGGLMGGGLQKEGVTTIGARYDFRMSTFRAQIDSKGKLSGL
LEKRVAPQVMMTFAADVDHYKVRMPSHRVQAPVLTALGSQQQAKLGLGISIESMPEELQDQGEMAAASTPPNNIP
F*
Coding >Ophun1|2254
ATGACTACCTCTACCATTGACTCGATACGCTCTCTCGTTCTCTCGAATCCTCTCGCCATTACGATAGGAGATGCC
ATCAATTCTTTCGCGGAACGCAGAGCCAAGCTTGGACTGTCAAATCCTGGATCCATCGAGTCCCTCACCAAAGAG
GTTCAGCGCGATGTCTTGCTCGGCAGCCTCATGTTCACTGGCGTCCGCGCCGACTTGACCAAAATTTTCAGCATG
GCGCCTCTCTTCCAAGTTTCCCACCAGTTCGCCATGAGCGGCGAGCGCATCAACCCTTACACCTTTGCCGCTATG
TACGGCACCGGCAAGGTATTTCTGCAGGGAAACTTGGACAACGAAGGCAGTCTGAGCGGCCGGTTCAACTACCGA
TGGACGGATAAGCTGGTGTCCAAGACGAATGTCTCCGTCTCCCCCGGCGGCCAGGACATGGCGCAATTCGAGCAC
GAATACACCGGCAACGACTTCACCGCCAACCTCAAGGTTTTGAATCCCTCGTTCTGGGATGGTGGAGTGACGGGT
ATCTGCATCGGAAGCTACCTGCAATCCCTGACCCCCCGCCTCGCCCTCGGACTCGAGACGCTCTGGCAACGGCCT
TCGCTGGCCCAAGGCCCCGAATGCGCTGTTTCGTACTGCGCTCGTTACAAGGCCAGCGATTGGATCGCCACCGCC
CAGCTGCAGGCCGCCATGGGAACGCTCAACACGTCGTACTGGAGGCGACTCTCGGACAAGGTCCAAGCCGGCGTC
GACCTGACCCTAGGCATCGTCCCCATTCCCGGCGGCTTGATGGGCGGCGGCCTACAGAAGGAGGGCGTCACGACC
ATCGGCGCCAGATATGACTTCCGCATGTCCACATTCCGAGCCCAGATCGATTCCAAGGGCAAGCTCAGCGGCCTG
CTGGAGAAGCGAGTGGCTCCTCAGGTCATGATGACCTTTGCCGCTGATGTCGACCACTACAAGGTTCGTATGCCT
TCCCATAGGGTGCAAGCGCCCGTACTGACAGCCCTGGGCTCGCAGCAACAAGCCAAGCTGGGCCTCGGCATCTCC
ATCGAGTCCATGCCCGAGGAATTGCAGGACCAGGGCGAAATGGCCGCCGCCTCGACGCCCCCGAATAACATCCCC
TTCTAG
Transcript >Ophun1|2254
ATGACTACCTCTACCATTGACTCGATACGCTCTCTCGTTCTCTCGAATCCTCTCGCCATTACGATAGGAGATGCC
ATCAATTCTTTCGCGGAACGCAGAGCCAAGCTTGGACTGTCAAATCCTGGATCCATCGAGTCCCTCACCAAAGAG
GTTCAGCGCGATGTCTTGCTCGGCAGCCTCATGTTCACTGGCGTCCGCGCCGACTTGACCAAAATTTTCAGCATG
GCGCCTCTCTTCCAAGTTTCCCACCAGTTCGCCATGAGCGGCGAGCGCATCAACCCTTACACCTTTGCCGCTATG
TACGGCACCGGCAAGGTATTTCTGCAGGGAAACTTGGACAACGAAGGCAGTCTGAGCGGCCGGTTCAACTACCGA
TGGACGGATAAGCTGGTGTCCAAGACGAATGTCTCCGTCTCCCCCGGCGGCCAGGACATGGCGCAATTCGAGCAC
GAATACACCGGCAACGACTTCACCGCCAACCTCAAGGTTTTGAATCCCTCGTTCTGGGATGGTGGAGTGACGGGT
ATCTGCATCGGAAGCTACCTGCAATCCCTGACCCCCCGCCTCGCCCTCGGACTCGAGACGCTCTGGCAACGGCCT
TCGCTGGCCCAAGGCCCCGAATGCGCTGTTTCGTACTGCGCTCGTTACAAGGCCAGCGATTGGATCGCCACCGCC
CAGCTGCAGGCCGCCATGGGAACGCTCAACACGTCGTACTGGAGGCGACTCTCGGACAAGGTCCAAGCCGGCGTC
GACCTGACCCTAGGCATCGTCCCCATTCCCGGCGGCTTGATGGGCGGCGGCCTACAGAAGGAGGGCGTCACGACC
ATCGGCGCCAGATATGACTTCCGCATGTCCACATTCCGAGCCCAGATCGATTCCAAGGGCAAGCTCAGCGGCCTG
CTGGAGAAGCGAGTGGCTCCTCAGGTCATGATGACCTTTGCCGCTGATGTCGACCACTACAAGGTTCGTATGCCT
TCCCATAGGGTGCAAGCGCCCGTACTGACAGCCCTGGGCTCGCAGCAACAAGCCAAGCTGGGCCTCGGCATCTCC
ATCGAGTCCATGCCCGAGGAATTGCAGGACCAGGGCGAAATGGCCGCCGCCTCGACGCCCCCGAATAACATCCCC
TTCTAG
Gene >Ophun1|2254
ATGACTACCTCTACCATTGACTCGATACGCTCTCTCGTTCTCTCGAATCCTCTCGCCATTACGATAGGAGATGCC
ATCAATTCTTTCGCGGAACGCAGAGCCAAGCTTGGACTGTCAAATCCTGGATCCATCGAGTCCCTCACCAAAGAG
GTTCAGCGCGATGTCTTGCTCGGCAGCCTCATGTTCACTGGCGTCCGCGCCGACTTGACCAAAATTTTCAGCATG
GCGCCTCTCTTCCAAGTTTCCCACCAGTTCGCCATGAGCGGCGAGCGCATCAACCCTTACACCTTTGCCGCTATG
TACGGCACCGGCAAGGTAGGCTCGAGAGAAGTTCCGTTCCTCTCTCATCGCCTGGAATTGACCCACTGTCGCCGC
AGGTATTTCTGCAGGGAAACTTGGACAACGAAGGCAGTCTGAGCGGCCGGTTCAACTACCGATGGACGGATAAGC
TGGTGTCCAAGACGAATGTCTCCGTCTCCCCCGGCGGCCAGGACATGGCGCAATTCGAGCACGAATACACCGGCA
ACGACTTCACCGCCAACCTCAAGGTTTTGAATCCCTCGTTCTGGGATGGTGGAGTGACGGGTATCTGCATCGGAA
GCTACCTGCAATCCCTGACCCCCCGCCTCGCCCTCGGACTCGAGACGCTCTGGCAACGGCCTTCGCTGGCCCAAG
GCCCCGAATGCGCTGTTTCGTACTGCGCTCGTTACAAGGCCAGCGATTGGATCGCCACCGCCCAGCTGCAGGCCG
CCATGGGAACGCTCAACACGTCGTACTGGAGGCGACTCTCGGACAAGGTCCAAGCCGGCGTCGACCTGACCCTAG
GCATCGTCCCCATTCCCGGCGGCTTGATGGGCGGCGGCCTACAGAAGGAGGGCGTCACGACCATCGGCGCCAGAT
ATGACTTCCGCATGTCCACATTCCGAGCCCAGATCGATTCCAAGGGCAAGCTCAGCGGCCTGCTGGAGAAGCGAG
TGGCTCCTCAGGTCATGATGACCTTTGCCGCTGATGTCGACCACTACAAGGTTCGTATGCCTTCCCATAGGGTGC
AAGCGCCCGTACTGACAGCCCTGGGCTCGCAGCAACAAGCCAAGCTGGGCCTCGGCATCTCCATCGAGTCCATGC
CCGAGGAATTGCAGGACCAGGGCGAAATGGCCGCCGCCTCGACGCCCCCGAATAACATCCCCTTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail