Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2251
Gene name
LocationContig_208:12060..15393
Strand-
Gene length (bp)3333
Transcript length (bp)3333
Coding sequence length (bp)3333
Protein length (aa) 1111

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00145 DNA_methylase C-5 cytosine-specific DNA methylase 7.2E-34 650 1042

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34881|DNMT1_ARATH DNA (cytosine-5)-methyltransferase 1 OS=Arabidopsis thaliana GN=DMT1 PE=1 SV=1 622 1052 1.0E-36
sp|Q9T0I1|DNMT3_ARATH DNA (cytosine-5)-methyltransferase 3 OS=Arabidopsis thaliana GN=MET3 PE=3 SV=1 645 1052 5.0E-34
sp|B1Q3J6|DNM1B_ORYSJ DNA (cytosine-5)-methyltransferase 1B OS=Oryza sativa subsp. japonica GN=MET1B PE=2 SV=1 648 1052 2.0E-33
sp|Q9Z330|DNMT1_RAT DNA (cytosine-5)-methyltransferase 1 OS=Rattus norvegicus GN=Dnmt1 PE=1 SV=2 540 1050 3.0E-33
sp|Q9M0S8|DNMT2_ARATH DNA (cytosine-5)-methyltransferase 2 OS=Arabidopsis thaliana GN=MET2 PE=2 SV=1 645 1052 1.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34881|DNMT1_ARATH DNA (cytosine-5)-methyltransferase 1 OS=Arabidopsis thaliana GN=DMT1 PE=1 SV=1 622 1052 1.0E-36
sp|Q9T0I1|DNMT3_ARATH DNA (cytosine-5)-methyltransferase 3 OS=Arabidopsis thaliana GN=MET3 PE=3 SV=1 645 1052 5.0E-34
sp|B1Q3J6|DNM1B_ORYSJ DNA (cytosine-5)-methyltransferase 1B OS=Oryza sativa subsp. japonica GN=MET1B PE=2 SV=1 648 1052 2.0E-33
sp|Q9Z330|DNMT1_RAT DNA (cytosine-5)-methyltransferase 1 OS=Rattus norvegicus GN=Dnmt1 PE=1 SV=2 540 1050 3.0E-33
sp|Q9M0S8|DNMT2_ARATH DNA (cytosine-5)-methyltransferase 2 OS=Arabidopsis thaliana GN=MET2 PE=2 SV=1 645 1052 1.0E-32
sp|Q7Y1I7|DNM1A_ORYSJ DNA (cytosine-5)-methyltransferase 1A OS=Oryza sativa subsp. japonica GN=MET1A PE=2 SV=1 649 1052 3.0E-31
sp|O23273|DNMT4_ARATH DNA (cytosine-5)-methyltransferase 4 OS=Arabidopsis thaliana GN=MET4 PE=2 SV=1 645 1052 3.0E-31
sp|Q27746|DNMT1_PARLI DNA (cytosine-5)-methyltransferase PliMCI OS=Paracentrotus lividus GN=DNMT PE=2 SV=1 648 1050 6.0E-30
sp|P13864|DNMT1_MOUSE DNA (cytosine-5)-methyltransferase 1 OS=Mus musculus GN=Dnmt1 PE=1 SV=5 494 901 3.0E-24
sp|P26358|DNMT1_HUMAN DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens GN=DNMT1 PE=1 SV=2 495 890 1.0E-23
sp|Q24K09|DNMT1_BOVIN DNA (cytosine-5)-methyltransferase 1 OS=Bos taurus GN=DNMT1 PE=2 SV=1 644 890 1.0E-22
sp|Q92072|DNMT1_CHICK DNA (cytosine-5)-methyltransferase 1 OS=Gallus gallus GN=DNMT1 PE=1 SV=1 495 890 2.0E-22
sp|O49139|CMT1_ARATH Putative DNA (cytosine-5)-methyltransferase CMT1 OS=Arabidopsis thaliana GN=CMT1 PE=5 SV=2 695 1052 7.0E-22
sp|P94147|MTA1_THAGE Modification methylase AgeI OS=Thalassobius gelatinovorus GN=ageIM PE=3 SV=1 649 1037 5.0E-20
sp|Q94F88|CMT3_ARATH DNA (cytosine-5)-methyltransferase CMT3 OS=Arabidopsis thaliana GN=CMT3 PE=1 SV=2 658 1054 3.0E-16
sp|Q9AXT8|CMT1_MAIZE DNA (cytosine-5)-methyltransferase 1 OS=Zea mays GN=MET2A PE=1 SV=1 694 1053 6.0E-15
sp|Q9ARI6|CMT2_MAIZE DNA (cytosine-5)-methyltransferase 2 OS=Zea mays GN=ZMET5 PE=2 SV=1 720 1053 6.0E-15
sp|Q8LPU5|CMT3_MAIZE DNA (cytosine-5)-methyltransferase 3 OS=Zea mays GN=DMT105 PE=2 SV=1 720 1053 9.0E-15
sp|Q94F87|CMT2_ARATH DNA (cytosine-5)-methyltransferase CMT2 OS=Arabidopsis thaliana GN=CMT2 PE=2 SV=3 701 1050 4.0E-13
sp|O34939|YDIO_BACSU Probable BsuMI modification methylase subunit YdiO OS=Bacillus subtilis (strain 168) GN=ydiO PE=2 SV=1 653 827 5.0E-11
sp|P05302|MTD1_DESNO Modification methylase DdeI OS=Desulfomicrobium norvegicum (strain DSM 1741 / NCIMB 8310) GN=ddeIM PE=3 SV=1 653 827 1.0E-08
sp|P25264|MTC2_HERAU Modification methylase HgiCII OS=Herpetosiphon aurantiacus GN=hgiCIIM PE=3 SV=1 646 827 4.0E-08
sp|P43420|MTB6_BACSF Modification methylase Bsp6I OS=Bacillus sp. (strain RFL6) GN=bsp6IM PE=3 SV=1 654 828 5.0E-07
sp|Q92072|DNMT1_CHICK DNA (cytosine-5)-methyltransferase 1 OS=Gallus gallus GN=DNMT1 PE=1 SV=1 970 1062 8.0E-07
sp|P26358|DNMT1_HUMAN DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens GN=DNMT1 PE=1 SV=2 970 1070 2.0E-06
sp|P16668|MTS3_STAAU Modification methylase Sau3AI OS=Staphylococcus aureus GN=sau3AIM PE=3 SV=1 646 827 2.0E-06
sp|Q24K09|DNMT1_BOVIN DNA (cytosine-5)-methyltransferase 1 OS=Bos taurus GN=DNMT1 PE=2 SV=1 970 1069 3.0E-06
sp|P13864|DNMT1_MOUSE DNA (cytosine-5)-methyltransferase 1 OS=Mus musculus GN=Dnmt1 PE=1 SV=5 970 1050 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3951
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6513
Ophiocordyceps australis map64 (Brazil) OphauB2|7611
Ophiocordyceps camponoti-floridani Ophcf2|00636
Ophiocordyceps camponoti-rufipedis Ophun1|2251 (this protein)
Ophiocordyceps kimflemingae Ophio5|8043
Ophiocordyceps subramaniannii Hirsu2|786

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2251
MQVQNGWLIEHDALVGSDLVSQDSSTKASERPSKNKTCRPICVEIPASTLMTPRAYFEPFESDVPVMPEPQALAM
LAMATQREAKGDFIEYDLDDFAVYRDAPPKYPRAMRSLHHLDQAGKHYFCGILSIGGKHKVMVEHVLIEAMPIGN
YGDRSKHTVRGHIWLRSDLNRRCETYYRLGTPAKEYARFFEPSLWVLDLGKHFVDFLKVSREHARRVDLHLFRST
FSTWLVRTHGQAPVFVEWFQQHPRADFRTSISANIAYLRKEAIGVLGERATYFHPIWSEVFDFRRYKQQPTAADS
RTVVTQYIYDCFEEMLFADQLVVVPISAKTESLRNRLIRERHLELPSALDACAVSLPNATDDEQTQNIRPGDTIS
TRRDGELSGSKWKREIPRGFDDVDRWFALVQKVQVGRDGVLFFDVIWYYRPVDTLCGLMKYPWNNELFLSDHCSC
DEARKIRADQVLGVHEVDFGGTSTTTSEFFCRQTYISEERKWISLTPEHRWCEHVVYRSLESPYQAGDTLLVLQK
PRDSFSEPCEVVSVEMEEKRVLYRLRKLLRRQRLEPQARPNELVYTNFLFQCGENSIVGRCHVRYFPANSEISTP
YDRDGVGAFFFMTHQEVVDELGRSSLVELESAPPSLRQGFDPAVEIPRLRGFDLFCGGGNFGRGLEEGGGIRMNW
ANDYDKQAIHTYMANVQPEDTVTPFLGSINDLQRRIILGNFSSAVPAIGKVDFVSGGSPCPGFSRLTNDKTCEKQ
RKNQSLVASFGSFIDLYRPRYGLLENVPGIVHGSLHRDQDAFSQLVCAVVGLGYQVELFFLDASSCGSSQRRSRV
FLALAAPGCRLPAKPAMTHAHPPGTRALKIGKLPNNESMAKREMPRATPFDFVSAADATADLPAIYDAKPDTCVA
FPDHRVSTARTHQQRLRISLIPKQPYGMNFALLQQSRVMTKTERNYFSSVKFNTLVRANGKPGGITCHSYGRQMP
GRLMETIVTTPNPCDGKNGRTLHWSEDRVISVMEARRSQGFRDDEVVLGMPPNQFKIVGNSVAREVALAFGIVFR
EAWEESLRTSGGMFKVQTEEWSESESSSATTTTTGSKRRSKLVVEIPVKRRRRSPSPASV*
Coding >Ophun1|2251
ATGCAGGTGCAAAATGGCTGGCTCATCGAGCACGATGCCCTTGTCGGCTCGGACCTCGTCTCCCAAGATTCTTCG
ACCAAGGCGTCCGAAAGACCGAGCAAGAACAAGACTTGCCGACCTATCTGCGTCGAGATTCCCGCGAGCACCCTC
ATGACACCCCGAGCGTACTTCGAACCGTTCGAATCCGATGTCCCCGTCATGCCTGAGCCTCAGGCTCTCGCGATG
CTAGCCATGGCCACGCAGCGAGAGGCTAAAGGCGACTTCATCGAATACGATCTAGACGACTTTGCCGTCTATCGC
GACGCGCCGCCCAAATATCCGCGCGCCATGAGGTCGCTGCACCATCTCGACCAAGCTGGCAAGCATTACTTCTGC
GGTATCCTTAGCATTGGGGGGAAGCACAAGGTCATGGTCGAGCACGTCCTTATAGAAGCTATGCCCATTGGTAAC
TATGGCGACCGCTCCAAGCACACGGTCCGTGGCCACATCTGGCTGCGGTCTGACCTTAACCGGCGCTGCGAGACC
TACTACAGGCTCGGGACGCCGGCCAAGGAGTACGCCCGCTTCTTCGAGCCCTCTCTTTGGGTTCTGGACTTGGGG
AAACACTTTGTTGACTTCTTGAAAGTCTCGAGGGAACACGCCAGGCGTGTTGATCTGCACCTCTTTCGAAGCACA
TTCAGCACCTGGCTCGTCAGGACGCACGGCCAGGCGCCCGTCTTCGTTGAGTGGTTCCAGCAGCATCCCCGAGCC
GACTTCAGAACCAGCATCAGCGCAAACATCGCATATCTGCGCAAAGAGGCTATTGGTGTCCTGGGCGAGCGCGCG
ACATATTTTCATCCTATATGGTCCGAAGTATTCGACTTTCGCCGATATAAACAGCAGCCGACAGCAGCCGACAGC
CGTACTGTCGTCACCCAGTACATATATGATTGCTTCGAGGAGATGCTCTTCGCAGACCAGCTCGTCGTGGTTCCC
ATCAGCGCCAAAACGGAAAGCCTTCGCAATAGACTCATCCGGGAACGCCATTTAGAGCTGCCCTCGGCGCTAGAC
GCCTGCGCCGTGAGCCTACCTAATGCGACGGATGACGAGCAGACGCAGAACATTCGGCCGGGCGATACCATCTCT
ACCCGTCGCGACGGCGAGTTATCGGGCAGCAAATGGAAGCGAGAGATACCGCGAGGCTTCGACGACGTCGACCGC
TGGTTCGCTCTGGTACAGAAAGTTCAAGTTGGCAGGGACGGCGTGCTCTTCTTTGACGTTATATGGTACTACCGA
CCAGTCGACACGCTGTGTGGGCTGATGAAGTACCCGTGGAACAACGAGCTATTTCTCTCGGACCACTGCTCCTGC
GATGAAGCGCGCAAGATCAGGGCGGACCAGGTGCTAGGTGTTCACGAGGTCGACTTTGGCGGCACTTCGACAACG
ACGTCTGAGTTCTTCTGCAGACAGACATACATCTCCGAAGAGCGGAAATGGATATCGCTCACACCGGAGCACAGG
TGGTGCGAGCACGTTGTGTACCGGAGCTTGGAGTCGCCCTACCAGGCCGGCGATACGCTGCTCGTCCTTCAAAAA
CCGCGAGACTCTTTCTCAGAACCCTGCGAGGTAGTTTCGGTCGAGATGGAGGAGAAGCGAGTTCTTTACCGGCTT
CGAAAGCTTCTACGGCGCCAGAGGCTAGAACCGCAGGCCCGGCCCAACGAGCTTGTCTATACCAACTTCCTATTC
CAGTGCGGAGAGAACAGCATTGTCGGCCGTTGTCATGTCCGCTACTTTCCGGCTAACTCTGAAATTTCTACGCCG
TACGATCGTGACGGCGTGGGGGCGTTCTTCTTTATGACGCATCAAGAGGTGGTCGACGAGTTAGGACGCTCTTCC
CTAGTCGAACTAGAATCGGCACCGCCCAGCCTCCGACAGGGCTTTGATCCGGCAGTCGAGATCCCGCGGCTTCGA
GGCTTCGATCTGTTCTGCGGTGGTGGCAACTTTGGACGCGGTCTTGAAGAGGGCGGCGGTATCCGGATGAACTGG
GCGAATGACTACGACAAGCAGGCTATCCATACGTACATGGCCAACGTACAGCCTGAGGACACGGTTACGCCCTTT
CTCGGCTCCATCAACGACCTACAGCGGCGGATCATCTTGGGCAACTTCTCGAGTGCGGTCCCTGCTATCGGCAAG
GTCGACTTCGTCTCCGGCGGCAGCCCCTGTCCGGGCTTCTCGCGGCTAACCAACGACAAGACGTGCGAGAAGCAG
CGCAAGAACCAGTCCCTGGTGGCCTCGTTTGGGTCGTTCATTGACTTATACCGGCCTAGGTATGGGCTTCTAGAG
AACGTCCCGGGCATCGTACACGGGTCTCTACATCGCGATCAGGACGCATTCAGCCAGCTCGTGTGCGCTGTAGTC
GGTCTCGGCTACCAGGTTGAGTTATTCTTCCTCGACGCATCTTCCTGCGGCTCGTCCCAGCGCCGATCACGCGTC
TTCCTGGCCCTTGCGGCGCCGGGCTGCCGACTCCCGGCCAAACCTGCCATGACGCACGCGCACCCGCCGGGGACA
CGGGCTCTCAAGATCGGCAAACTCCCGAATAACGAGTCTATGGCCAAGCGGGAGATGCCCCGGGCCACACCATTT
GACTTCGTCTCGGCCGCCGACGCGACGGCCGACCTCCCGGCCATTTATGATGCCAAGCCCGATACGTGCGTCGCC
TTCCCCGATCATCGCGTCTCGACGGCGAGAACGCACCAGCAGAGGCTACGCATAAGTCTCATCCCCAAGCAGCCG
TACGGCATGAACTTTGCCCTACTTCAGCAGAGCCGCGTCATGACCAAGACCGAACGGAACTACTTTTCCAGTGTC
AAGTTCAACACCTTGGTAAGGGCCAATGGCAAACCCGGGGGTATAACATGCCACTCGTACGGGCGACAGATGCCT
GGCCGGCTGATGGAGACGATCGTGACGACGCCGAACCCGTGCGATGGCAAGAATGGCCGCACACTGCACTGGTCC
GAGGACCGCGTCATCTCCGTCATGGAGGCCCGGCGCTCCCAGGGCTTCCGCGACGACGAGGTGGTGCTGGGCATG
CCGCCGAATCAGTTCAAGATTGTGGGTAACAGCGTTGCCAGGGAGGTGGCCCTCGCCTTTGGCATCGTCTTTCGC
GAGGCCTGGGAAGAGAGCCTGCGGACGAGCGGCGGAATGTTCAAGGTGCAGACGGAGGAGTGGTCTGAGAGCGAG
AGCTCCTCGGCGACAACGACGACGACGGGCAGCAAGCGGCGCAGCAAGCTGGTGGTGGAGATTCCCGTCAAGCGA
AGACGGAGGAGCCCCTCACCGGCGTCGGTGTAA
Transcript >Ophun1|2251
ATGCAGGTGCAAAATGGCTGGCTCATCGAGCACGATGCCCTTGTCGGCTCGGACCTCGTCTCCCAAGATTCTTCG
ACCAAGGCGTCCGAAAGACCGAGCAAGAACAAGACTTGCCGACCTATCTGCGTCGAGATTCCCGCGAGCACCCTC
ATGACACCCCGAGCGTACTTCGAACCGTTCGAATCCGATGTCCCCGTCATGCCTGAGCCTCAGGCTCTCGCGATG
CTAGCCATGGCCACGCAGCGAGAGGCTAAAGGCGACTTCATCGAATACGATCTAGACGACTTTGCCGTCTATCGC
GACGCGCCGCCCAAATATCCGCGCGCCATGAGGTCGCTGCACCATCTCGACCAAGCTGGCAAGCATTACTTCTGC
GGTATCCTTAGCATTGGGGGGAAGCACAAGGTCATGGTCGAGCACGTCCTTATAGAAGCTATGCCCATTGGTAAC
TATGGCGACCGCTCCAAGCACACGGTCCGTGGCCACATCTGGCTGCGGTCTGACCTTAACCGGCGCTGCGAGACC
TACTACAGGCTCGGGACGCCGGCCAAGGAGTACGCCCGCTTCTTCGAGCCCTCTCTTTGGGTTCTGGACTTGGGG
AAACACTTTGTTGACTTCTTGAAAGTCTCGAGGGAACACGCCAGGCGTGTTGATCTGCACCTCTTTCGAAGCACA
TTCAGCACCTGGCTCGTCAGGACGCACGGCCAGGCGCCCGTCTTCGTTGAGTGGTTCCAGCAGCATCCCCGAGCC
GACTTCAGAACCAGCATCAGCGCAAACATCGCATATCTGCGCAAAGAGGCTATTGGTGTCCTGGGCGAGCGCGCG
ACATATTTTCATCCTATATGGTCCGAAGTATTCGACTTTCGCCGATATAAACAGCAGCCGACAGCAGCCGACAGC
CGTACTGTCGTCACCCAGTACATATATGATTGCTTCGAGGAGATGCTCTTCGCAGACCAGCTCGTCGTGGTTCCC
ATCAGCGCCAAAACGGAAAGCCTTCGCAATAGACTCATCCGGGAACGCCATTTAGAGCTGCCCTCGGCGCTAGAC
GCCTGCGCCGTGAGCCTACCTAATGCGACGGATGACGAGCAGACGCAGAACATTCGGCCGGGCGATACCATCTCT
ACCCGTCGCGACGGCGAGTTATCGGGCAGCAAATGGAAGCGAGAGATACCGCGAGGCTTCGACGACGTCGACCGC
TGGTTCGCTCTGGTACAGAAAGTTCAAGTTGGCAGGGACGGCGTGCTCTTCTTTGACGTTATATGGTACTACCGA
CCAGTCGACACGCTGTGTGGGCTGATGAAGTACCCGTGGAACAACGAGCTATTTCTCTCGGACCACTGCTCCTGC
GATGAAGCGCGCAAGATCAGGGCGGACCAGGTGCTAGGTGTTCACGAGGTCGACTTTGGCGGCACTTCGACAACG
ACGTCTGAGTTCTTCTGCAGACAGACATACATCTCCGAAGAGCGGAAATGGATATCGCTCACACCGGAGCACAGG
TGGTGCGAGCACGTTGTGTACCGGAGCTTGGAGTCGCCCTACCAGGCCGGCGATACGCTGCTCGTCCTTCAAAAA
CCGCGAGACTCTTTCTCAGAACCCTGCGAGGTAGTTTCGGTCGAGATGGAGGAGAAGCGAGTTCTTTACCGGCTT
CGAAAGCTTCTACGGCGCCAGAGGCTAGAACCGCAGGCCCGGCCCAACGAGCTTGTCTATACCAACTTCCTATTC
CAGTGCGGAGAGAACAGCATTGTCGGCCGTTGTCATGTCCGCTACTTTCCGGCTAACTCTGAAATTTCTACGCCG
TACGATCGTGACGGCGTGGGGGCGTTCTTCTTTATGACGCATCAAGAGGTGGTCGACGAGTTAGGACGCTCTTCC
CTAGTCGAACTAGAATCGGCACCGCCCAGCCTCCGACAGGGCTTTGATCCGGCAGTCGAGATCCCGCGGCTTCGA
GGCTTCGATCTGTTCTGCGGTGGTGGCAACTTTGGACGCGGTCTTGAAGAGGGCGGCGGTATCCGGATGAACTGG
GCGAATGACTACGACAAGCAGGCTATCCATACGTACATGGCCAACGTACAGCCTGAGGACACGGTTACGCCCTTT
CTCGGCTCCATCAACGACCTACAGCGGCGGATCATCTTGGGCAACTTCTCGAGTGCGGTCCCTGCTATCGGCAAG
GTCGACTTCGTCTCCGGCGGCAGCCCCTGTCCGGGCTTCTCGCGGCTAACCAACGACAAGACGTGCGAGAAGCAG
CGCAAGAACCAGTCCCTGGTGGCCTCGTTTGGGTCGTTCATTGACTTATACCGGCCTAGGTATGGGCTTCTAGAG
AACGTCCCGGGCATCGTACACGGGTCTCTACATCGCGATCAGGACGCATTCAGCCAGCTCGTGTGCGCTGTAGTC
GGTCTCGGCTACCAGGTTGAGTTATTCTTCCTCGACGCATCTTCCTGCGGCTCGTCCCAGCGCCGATCACGCGTC
TTCCTGGCCCTTGCGGCGCCGGGCTGCCGACTCCCGGCCAAACCTGCCATGACGCACGCGCACCCGCCGGGGACA
CGGGCTCTCAAGATCGGCAAACTCCCGAATAACGAGTCTATGGCCAAGCGGGAGATGCCCCGGGCCACACCATTT
GACTTCGTCTCGGCCGCCGACGCGACGGCCGACCTCCCGGCCATTTATGATGCCAAGCCCGATACGTGCGTCGCC
TTCCCCGATCATCGCGTCTCGACGGCGAGAACGCACCAGCAGAGGCTACGCATAAGTCTCATCCCCAAGCAGCCG
TACGGCATGAACTTTGCCCTACTTCAGCAGAGCCGCGTCATGACCAAGACCGAACGGAACTACTTTTCCAGTGTC
AAGTTCAACACCTTGGTAAGGGCCAATGGCAAACCCGGGGGTATAACATGCCACTCGTACGGGCGACAGATGCCT
GGCCGGCTGATGGAGACGATCGTGACGACGCCGAACCCGTGCGATGGCAAGAATGGCCGCACACTGCACTGGTCC
GAGGACCGCGTCATCTCCGTCATGGAGGCCCGGCGCTCCCAGGGCTTCCGCGACGACGAGGTGGTGCTGGGCATG
CCGCCGAATCAGTTCAAGATTGTGGGTAACAGCGTTGCCAGGGAGGTGGCCCTCGCCTTTGGCATCGTCTTTCGC
GAGGCCTGGGAAGAGAGCCTGCGGACGAGCGGCGGAATGTTCAAGGTGCAGACGGAGGAGTGGTCTGAGAGCGAG
AGCTCCTCGGCGACAACGACGACGACGGGCAGCAAGCGGCGCAGCAAGCTGGTGGTGGAGATTCCCGTCAAGCGA
AGACGGAGGAGCCCCTCACCGGCGTCGGTGTAA
Gene >Ophun1|2251
ATGCAGGTGCAAAATGGCTGGCTCATCGAGCACGATGCCCTTGTCGGCTCGGACCTCGTCTCCCAAGATTCTTCG
ACCAAGGCGTCCGAAAGACCGAGCAAGAACAAGACTTGCCGACCTATCTGCGTCGAGATTCCCGCGAGCACCCTC
ATGACACCCCGAGCGTACTTCGAACCGTTCGAATCCGATGTCCCCGTCATGCCTGAGCCTCAGGCTCTCGCGATG
CTAGCCATGGCCACGCAGCGAGAGGCTAAAGGCGACTTCATCGAATACGATCTAGACGACTTTGCCGTCTATCGC
GACGCGCCGCCCAAATATCCGCGCGCCATGAGGTCGCTGCACCATCTCGACCAAGCTGGCAAGCATTACTTCTGC
GGTATCCTTAGCATTGGGGGGAAGCACAAGGTCATGGTCGAGCACGTCCTTATAGAAGCTATGCCCATTGGTAAC
TATGGCGACCGCTCCAAGCACACGGTCCGTGGCCACATCTGGCTGCGGTCTGACCTTAACCGGCGCTGCGAGACC
TACTACAGGCTCGGGACGCCGGCCAAGGAGTACGCCCGCTTCTTCGAGCCCTCTCTTTGGGTTCTGGACTTGGGG
AAACACTTTGTTGACTTCTTGAAAGTCTCGAGGGAACACGCCAGGCGTGTTGATCTGCACCTCTTTCGAAGCACA
TTCAGCACCTGGCTCGTCAGGACGCACGGCCAGGCGCCCGTCTTCGTTGAGTGGTTCCAGCAGCATCCCCGAGCC
GACTTCAGAACCAGCATCAGCGCAAACATCGCATATCTGCGCAAAGAGGCTATTGGTGTCCTGGGCGAGCGCGCG
ACATATTTTCATCCTATATGGTCCGAAGTATTCGACTTTCGCCGATATAAACAGCAGCCGACAGCAGCCGACAGC
CGTACTGTCGTCACCCAGTACATATATGATTGCTTCGAGGAGATGCTCTTCGCAGACCAGCTCGTCGTGGTTCCC
ATCAGCGCCAAAACGGAAAGCCTTCGCAATAGACTCATCCGGGAACGCCATTTAGAGCTGCCCTCGGCGCTAGAC
GCCTGCGCCGTGAGCCTACCTAATGCGACGGATGACGAGCAGACGCAGAACATTCGGCCGGGCGATACCATCTCT
ACCCGTCGCGACGGCGAGTTATCGGGCAGCAAATGGAAGCGAGAGATACCGCGAGGCTTCGACGACGTCGACCGC
TGGTTCGCTCTGGTACAGAAAGTTCAAGTTGGCAGGGACGGCGTGCTCTTCTTTGACGTTATATGGTACTACCGA
CCAGTCGACACGCTGTGTGGGCTGATGAAGTACCCGTGGAACAACGAGCTATTTCTCTCGGACCACTGCTCCTGC
GATGAAGCGCGCAAGATCAGGGCGGACCAGGTGCTAGGTGTTCACGAGGTCGACTTTGGCGGCACTTCGACAACG
ACGTCTGAGTTCTTCTGCAGACAGACATACATCTCCGAAGAGCGGAAATGGATATCGCTCACACCGGAGCACAGG
TGGTGCGAGCACGTTGTGTACCGGAGCTTGGAGTCGCCCTACCAGGCCGGCGATACGCTGCTCGTCCTTCAAAAA
CCGCGAGACTCTTTCTCAGAACCCTGCGAGGTAGTTTCGGTCGAGATGGAGGAGAAGCGAGTTCTTTACCGGCTT
CGAAAGCTTCTACGGCGCCAGAGGCTAGAACCGCAGGCCCGGCCCAACGAGCTTGTCTATACCAACTTCCTATTC
CAGTGCGGAGAGAACAGCATTGTCGGCCGTTGTCATGTCCGCTACTTTCCGGCTAACTCTGAAATTTCTACGCCG
TACGATCGTGACGGCGTGGGGGCGTTCTTCTTTATGACGCATCAAGAGGTGGTCGACGAGTTAGGACGCTCTTCC
CTAGTCGAACTAGAATCGGCACCGCCCAGCCTCCGACAGGGCTTTGATCCGGCAGTCGAGATCCCGCGGCTTCGA
GGCTTCGATCTGTTCTGCGGTGGTGGCAACTTTGGACGCGGTCTTGAAGAGGGCGGCGGTATCCGGATGAACTGG
GCGAATGACTACGACAAGCAGGCTATCCATACGTACATGGCCAACGTACAGCCTGAGGACACGGTTACGCCCTTT
CTCGGCTCCATCAACGACCTACAGCGGCGGATCATCTTGGGCAACTTCTCGAGTGCGGTCCCTGCTATCGGCAAG
GTCGACTTCGTCTCCGGCGGCAGCCCCTGTCCGGGCTTCTCGCGGCTAACCAACGACAAGACGTGCGAGAAGCAG
CGCAAGAACCAGTCCCTGGTGGCCTCGTTTGGGTCGTTCATTGACTTATACCGGCCTAGGTATGGGCTTCTAGAG
AACGTCCCGGGCATCGTACACGGGTCTCTACATCGCGATCAGGACGCATTCAGCCAGCTCGTGTGCGCTGTAGTC
GGTCTCGGCTACCAGGTTGAGTTATTCTTCCTCGACGCATCTTCCTGCGGCTCGTCCCAGCGCCGATCACGCGTC
TTCCTGGCCCTTGCGGCGCCGGGCTGCCGACTCCCGGCCAAACCTGCCATGACGCACGCGCACCCGCCGGGGACA
CGGGCTCTCAAGATCGGCAAACTCCCGAATAACGAGTCTATGGCCAAGCGGGAGATGCCCCGGGCCACACCATTT
GACTTCGTCTCGGCCGCCGACGCGACGGCCGACCTCCCGGCCATTTATGATGCCAAGCCCGATACGTGCGTCGCC
TTCCCCGATCATCGCGTCTCGACGGCGAGAACGCACCAGCAGAGGCTACGCATAAGTCTCATCCCCAAGCAGCCG
TACGGCATGAACTTTGCCCTACTTCAGCAGAGCCGCGTCATGACCAAGACCGAACGGAACTACTTTTCCAGTGTC
AAGTTCAACACCTTGGTAAGGGCCAATGGCAAACCCGGGGGTATAACATGCCACTCGTACGGGCGACAGATGCCT
GGCCGGCTGATGGAGACGATCGTGACGACGCCGAACCCGTGCGATGGCAAGAATGGCCGCACACTGCACTGGTCC
GAGGACCGCGTCATCTCCGTCATGGAGGCCCGGCGCTCCCAGGGCTTCCGCGACGACGAGGTGGTGCTGGGCATG
CCGCCGAATCAGTTCAAGATTGTGGGTAACAGCGTTGCCAGGGAGGTGGCCCTCGCCTTTGGCATCGTCTTTCGC
GAGGCCTGGGAAGAGAGCCTGCGGACGAGCGGCGGAATGTTCAAGGTGCAGACGGAGGAGTGGTCTGAGAGCGAG
AGCTCCTCGGCGACAACGACGACGACGGGCAGCAAGCGGCGCAGCAAGCTGGTGGTGGAGATTCCCGTCAAGCGA
AGACGGAGGAGCCCCTCACCGGCGTCGGTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail