Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|225
Gene name
LocationContig_1048:2072..3595
Strand+
Gene length (bp)1523
Transcript length (bp)1401
Coding sequence length (bp)1401
Protein length (aa) 467

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08645 PNK3P Polynucleotide kinase 3 phosphatase 8.7E-53 94 270
PF13671 AAA_33 AAA domain 7.9E-27 309 435

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13911|PNK1_SCHPO Bifunctional polynucleotide phosphatase/kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pnk1 PE=1 SV=2 98 465 2.0E-75
sp|Q96T60|PNKP_HUMAN Bifunctional polynucleotide phosphatase/kinase OS=Homo sapiens GN=PNKP PE=1 SV=1 94 451 9.0E-63
sp|Q9JLV6|PNKP_MOUSE Bifunctional polynucleotide phosphatase/kinase OS=Mus musculus GN=Pnkp PE=1 SV=2 94 452 2.0E-59
sp|Q19683|YZR5_CAEEL Uncharacterized protein F21D5.5 OS=Caenorhabditis elegans GN=F21D5.5 PE=2 SV=2 94 459 2.0E-55
sp|Q5UQD2|PNKP_MIMIV Putative bifunctional polynucleotide phosphatase/kinase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L469 PE=3 SV=1 93 463 2.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13911|PNK1_SCHPO Bifunctional polynucleotide phosphatase/kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pnk1 PE=1 SV=2 98 465 2.0E-75
sp|Q96T60|PNKP_HUMAN Bifunctional polynucleotide phosphatase/kinase OS=Homo sapiens GN=PNKP PE=1 SV=1 94 451 9.0E-63
sp|Q9JLV6|PNKP_MOUSE Bifunctional polynucleotide phosphatase/kinase OS=Mus musculus GN=Pnkp PE=1 SV=2 94 452 2.0E-59
sp|Q19683|YZR5_CAEEL Uncharacterized protein F21D5.5 OS=Caenorhabditis elegans GN=F21D5.5 PE=2 SV=2 94 459 2.0E-55
sp|Q5UQD2|PNKP_MIMIV Putative bifunctional polynucleotide phosphatase/kinase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L469 PE=3 SV=1 93 463 2.0E-45
sp|P21286|Y033_NPVAC Uncharacterized 20.8 kDa protein in FGF-VUBI intergenic region OS=Autographa californica nuclear polyhedrosis virus PE=3 SV=2 91 270 2.0E-21
sp|Q84JE8|ZDP_ARATH Polynucleotide 3'-phosphatase ZDP OS=Arabidopsis thaliana GN=ZDP PE=1 SV=1 94 271 2.0E-15
sp|Q9M041|BH140_ARATH Transcription factor bHLH140 OS=Arabidopsis thaliana GN=BHLH140 PE=3 SV=1 306 444 3.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|225
MILLVRLARRVSMAPSSPKGKRRAGDAPRSPQASKRTVQSSTTQSAVASFFTPVSQKPKDRVVWSQRALDAGATP
TLLVGRYDTDDAELMRRCKMAVFDLDSTLIVPSSGKKHASGASDWKWWHPSVPTKLRQLHHEQGYRIVILSNQAG
LSLQPPASSSKAPKAGILRRTADFKHKCASVLANLDLPTTVYAATERDAFRKPRTAMWTQACRDYDVAESDVDMQ
GSFFVGDAGGRIASPDRGFAKDFSCSDRNFAHNVGIDFKTPEEFFLGLPPRDFRRELDLVRYPFAESDGEQQPPV
FRRTNKRDVVLFCGPPGAGKSTFYRNYLEPLGYERVNQDTLKSRDKCVRTARDLLREGSSVAVDNTNADPETRAI
WVQLAKTAGVPIRCVWFKTPLAVCEHNDAVRALNPSLNPEARTGLPKLAFTGFSSRFKEPKVSEGFEDVGEVEFE
FRGSRSEYEVWGRYWT*
Coding >Ophun1|225
ATGATCCTGCTCGTCCGTCTGGCGCGTCGCGTCAGCATGGCGCCCTCCAGTCCGAAAGGCAAGCGCAGGGCAGGC
GACGCGCCAAGATCGCCACAGGCGTCGAAGCGAACGGTACAGAGTAGCACGACACAGAGCGCCGTCGCCAGCTTC
TTTACGCCTGTTTCGCAGAAGCCAAAGGATCGCGTTGTCTGGTCGCAGCGTGCTCTTGATGCTGGCGCGACGCCT
ACGTTGCTTGTCGGTCGTTATGATACGGACGATGCGGAGCTGATGAGGCGGTGCAAGATGGCCGTCTTTGATCTG
GATTCGACGCTCATCGTTCCATCTTCCGGCAAGAAACACGCGAGCGGCGCGTCAGACTGGAAATGGTGGCACCCA
TCGGTGCCTACGAAGCTGCGCCAGCTACACCACGAACAAGGCTATCGCATCGTCATCCTCTCCAACCAGGCCGGC
CTATCGCTACAGCCGCCGGCCTCAAGTTCTAAAGCTCCCAAGGCGGGGATACTGAGGCGAACAGCCGACTTCAAG
CACAAGTGCGCCTCGGTGCTCGCAAACCTCGATCTACCCACGACGGTGTATGCCGCGACGGAGAGGGACGCTTTC
CGCAAGCCGCGCACGGCCATGTGGACGCAGGCGTGTCGCGACTACGACGTGGCTGAGAGCGACGTCGATATGCAG
GGCAGTTTCTTTGTCGGCGATGCAGGCGGTCGGATAGCGAGCCCGGACCGCGGCTTTGCAAAGGACTTTAGCTGC
TCGGATAGGAACTTTGCTCACAACGTCGGCATTGATTTCAAGACGCCCGAAGAGTTCTTTCTGGGCCTGCCGCCT
AGGGACTTTCGCCGCGAGCTGGACCTGGTTCGCTATCCGTTTGCCGAAAGCGATGGCGAGCAGCAGCCGCCGGTC
TTTCGGAGGACGAACAAGAGGGACGTGGTCTTGTTCTGCGGTCCTCCGGGGGCCGGGAAGAGCACCTTTTACCGG
AACTATCTCGAGCCGCTGGGCTACGAGCGCGTCAACCAGGACACGCTCAAGAGCCGGGACAAGTGTGTCCGCACG
GCGAGGGATCTGCTCCGCGAAGGCTCCTCGGTAGCCGTCGACAACACCAATGCCGATCCAGAGACGCGAGCCATC
TGGGTGCAATTGGCCAAAACGGCCGGCGTCCCGATTCGCTGCGTTTGGTTCAAGACGCCGCTGGCCGTATGTGAG
CACAACGACGCGGTGCGGGCCCTGAACCCATCTCTCAACCCGGAGGCGAGAACGGGCCTCCCGAAGCTGGCCTTT
ACCGGCTTCTCTTCGCGCTTCAAGGAGCCCAAGGTGTCGGAGGGCTTCGAGGACGTTGGCGAGGTCGAGTTCGAG
TTCCGTGGGTCGCGGTCGGAGTATGAGGTGTGGGGGCGATATTGGACGTGA
Transcript >Ophun1|225
ATGATCCTGCTCGTCCGTCTGGCGCGTCGCGTCAGCATGGCGCCCTCCAGTCCGAAAGGCAAGCGCAGGGCAGGC
GACGCGCCAAGATCGCCACAGGCGTCGAAGCGAACGGTACAGAGTAGCACGACACAGAGCGCCGTCGCCAGCTTC
TTTACGCCTGTTTCGCAGAAGCCAAAGGATCGCGTTGTCTGGTCGCAGCGTGCTCTTGATGCTGGCGCGACGCCT
ACGTTGCTTGTCGGTCGTTATGATACGGACGATGCGGAGCTGATGAGGCGGTGCAAGATGGCCGTCTTTGATCTG
GATTCGACGCTCATCGTTCCATCTTCCGGCAAGAAACACGCGAGCGGCGCGTCAGACTGGAAATGGTGGCACCCA
TCGGTGCCTACGAAGCTGCGCCAGCTACACCACGAACAAGGCTATCGCATCGTCATCCTCTCCAACCAGGCCGGC
CTATCGCTACAGCCGCCGGCCTCAAGTTCTAAAGCTCCCAAGGCGGGGATACTGAGGCGAACAGCCGACTTCAAG
CACAAGTGCGCCTCGGTGCTCGCAAACCTCGATCTACCCACGACGGTGTATGCCGCGACGGAGAGGGACGCTTTC
CGCAAGCCGCGCACGGCCATGTGGACGCAGGCGTGTCGCGACTACGACGTGGCTGAGAGCGACGTCGATATGCAG
GGCAGTTTCTTTGTCGGCGATGCAGGCGGTCGGATAGCGAGCCCGGACCGCGGCTTTGCAAAGGACTTTAGCTGC
TCGGATAGGAACTTTGCTCACAACGTCGGCATTGATTTCAAGACGCCCGAAGAGTTCTTTCTGGGCCTGCCGCCT
AGGGACTTTCGCCGCGAGCTGGACCTGGTTCGCTATCCGTTTGCCGAAAGCGATGGCGAGCAGCAGCCGCCGGTC
TTTCGGAGGACGAACAAGAGGGACGTGGTCTTGTTCTGCGGTCCTCCGGGGGCCGGGAAGAGCACCTTTTACCGG
AACTATCTCGAGCCGCTGGGCTACGAGCGCGTCAACCAGGACACGCTCAAGAGCCGGGACAAGTGTGTCCGCACG
GCGAGGGATCTGCTCCGCGAAGGCTCCTCGGTAGCCGTCGACAACACCAATGCCGATCCAGAGACGCGAGCCATC
TGGGTGCAATTGGCCAAAACGGCCGGCGTCCCGATTCGCTGCGTTTGGTTCAAGACGCCGCTGGCCGTATGTGAG
CACAACGACGCGGTGCGGGCCCTGAACCCATCTCTCAACCCGGAGGCGAGAACGGGCCTCCCGAAGCTGGCCTTT
ACCGGCTTCTCTTCGCGCTTCAAGGAGCCCAAGGTGTCGGAGGGCTTCGAGGACGTTGGCGAGGTCGAGTTCGAG
TTCCGTGGGTCGCGGTCGGAGTATGAGGTGTGGGGGCGATATTGGACGTGA
Gene >Ophun1|225
ATGATCCTGCTCGTCCGTCTGGCGCGTCGCGTCAGCATGGCGCCCTCCAGTCCGAAAGGCAAGCGCAGGGCAGGC
GACGCGCCAAGATCGCCACAGGCGTCGAAGCGAACGGTACAGAGTAGCACGACACGTACGAGATGGCTTGCCGCC
GACGAAAGCAGCCGCTGGCTGACTGTTTTCGGCCTCCAGAGAGCGCCGTCGCCAGCTTCTTTACGCCTGTTTCGC
AGAAGCCAAAGGATCGCGTTGTCTGGTCGCAGCGTGCTCTTGATGCTGGCGCGACGCCTACGTTGCTTGTCGGTC
GTTATGATACGGACGATGCGGAGCTGATGAGGCGGTGCAAGATGGCCGTCTTTGATCTGGATTCGACGCTCATCG
TTCCATCTTCCGGCAAGAAACACGCGAGCGGCGCGTCAGACTGGAAATGGTGGCACCCATCGGTGCCTACGAAGC
TGCGCCAGCTACACCACGAACAAGGCTATCGCATCGTCATCCTCTCCAACCAGGCCGGCCTATCGCTACAGCCGC
CGGCCTCAAGTTCTAAAGCTCCCAAGGCGGGGATACTGAGGCGAACAGCCGACTTCAAGCACAAGTGCGCCTCGG
TGCTCGCAAACCTCGATCTACCCACGACGGTGTATGCCGCGACGGAGAGGGACGCTTTCCGCAAGCCGCGCACGG
CCATGTGGACGCAGGCGTGTCGCGACTACGACGTGGCTGAGAGCGACGTCGATATGCAGGGCAGTTTCTTTGTCG
GCGATGCAGGCGGTCGGATAGCGAGCCCGGACCGCGGCTTTGCAAAGGACTTTAGCTGCTCGGATAGGAACTTTG
CTCACAACGTCGGCATTGATTTCAAGACGCCCGAAGAGTTCTTTCTGGGCCTGCCGCCTAGGGACTTTCGCCGCG
AGCTGGACCTGGTTCGCTATCCGTTTGCCGAAAGCGATGGCGAGCAGCAGCCGCCGGTCTTTCGGAGGACGAACA
AGAGGGACGTGGTCTTGTTCTGCGGTCCTCCGGGGGCCGGGAAGAGCACCTTTTACCGGAACTATCTCGAGCCGC
TGGGCTACGAGCGCGTCAACCAGGACACGCTCAAGAGCCGGGACAAGTGTGTCCGCACGGCGAGGGATCTGCTCC
GCGAAGGCTCCTCGGTAGCCGTCGGTTAGTCTGTGAATGTACGTCTACAGGAGAACTCGGAGGAAGCTGACGCGA
AGGGAGCTACAGACAACACCAATGCCGATCCAGAGACGCGAGCCATCTGGGTGCAATTGGCCAAAACGGCCGGCG
TCCCGATTCGCTGCGTTTGGTTCAAGACGCCGCTGGCCGTATGTGAGCACAACGACGCGGTGCGGGCCCTGAACC
CATCTCTCAACCCGGAGGCGAGAACGGGCCTCCCGAAGCTGGCCTTTACCGGCTTCTCTTCGCGCTTCAAGGAGC
CCAAGGTGTCGGAGGGCTTCGAGGACGTTGGCGAGGTCGAGTTCGAGTTCCGTGGGTCGCGGTCGGAGTATGAGG
TGTGGGGGCGATATTGGACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail