Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2246
Gene name
LocationContig_208:4056..4629
Strand-
Gene length (bp)573
Transcript length (bp)513
Coding sequence length (bp)513
Protein length (aa) 171

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4983
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6515
Ophiocordyceps australis map64 (Brazil) OphauB2|7613
Ophiocordyceps camponoti-rufipedis Ophun1|2246 (this protein)
Ophiocordyceps kimflemingae Ophio5|4812
Ophiocordyceps subramaniannii Hirsu2|2210

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2246
MTSVISIPAARPTAFPERPKPAGGSSASSYSSSSSPSSPSSTAGAAKTVHTRRPRLLSMAPIGGEVYKESWLTAV
SATGSAISKQQCTVINIGDPDGPPRLISYLSSSQGFAWNPGRRTPHHAQLLLTRVYIEIFLPNHVDCDYEPLENQ
CEPVHEIVLSDEESTNLLPQ*
Coding >Ophun1|2246
ATGACGTCCGTCATCAGCATCCCCGCCGCCCGTCCGACGGCTTTCCCCGAGAGGCCAAAGCCGGCCGGCGGCTCG
TCGGCGAGCTCTTACTCCAGCTCGTCGTCACCCTCGTCGCCCTCGTCGACGGCCGGCGCGGCCAAGACGGTGCAC
ACCCGTCGTCCGAGGCTGCTGAGTATGGCTCCTATTGGTGGCGAGGTATATAAGGAGAGCTGGCTGACGGCCGTG
TCCGCTACAGGTTCCGCCATCTCCAAGCAGCAGTGCACTGTCATCAACATCGGCGACCCGGATGGCCCTCCTCGG
CTGATCTCATACCTGTCGTCGAGCCAAGGCTTTGCCTGGAACCCTGGTAGGCGGACGCCGCATCACGCCCAGCTT
TTGCTGACGCGAGTGTACATAGAAATCTTCCTCCCGAACCACGTCGACTGCGACTACGAACCGCTCGAAAACCAG
TGCGAACCGGTGCACGAGATTGTACTGAGCGACGAGGAGTCGACCAATCTTCTTCCTCAATGA
Transcript >Ophun1|2246
ATGACGTCCGTCATCAGCATCCCCGCCGCCCGTCCGACGGCTTTCCCCGAGAGGCCAAAGCCGGCCGGCGGCTCG
TCGGCGAGCTCTTACTCCAGCTCGTCGTCACCCTCGTCGCCCTCGTCGACGGCCGGCGCGGCCAAGACGGTGCAC
ACCCGTCGTCCGAGGCTGCTGAGTATGGCTCCTATTGGTGGCGAGGTATATAAGGAGAGCTGGCTGACGGCCGTG
TCCGCTACAGGTTCCGCCATCTCCAAGCAGCAGTGCACTGTCATCAACATCGGCGACCCGGATGGCCCTCCTCGG
CTGATCTCATACCTGTCGTCGAGCCAAGGCTTTGCCTGGAACCCTGGTAGGCGGACGCCGCATCACGCCCAGCTT
TTGCTGACGCGAGTGTACATAGAAATCTTCCTCCCGAACCACGTCGACTGCGACTACGAACCGCTCGAAAACCAG
TGCGAACCGGTGCACGAGATTGTACTGAGCGACGAGGAGTCGACCAATCTTCTTCCTCAATGA
Gene >Ophun1|2246
ATGACGTCCGTCATCAGCATCCCCGCCGCCCGTCCGACGGCTTTCCCCGAGAGGCCAAAGCCGGCCGGCGGCTCG
TCGGCGAGCTCTTACTCCAGCTCGTCGTCACCCTCGTCGCCCTCGTCGACGGCCGGCGCGGCCAAGACGGTGCAC
ACCCGTCGTCCGAGGCTGCTGAGTATGGCTCCTATTGGTGGCGAGGTATATAAGGAGAGCTGGCTGACGGCCGTG
TCCGCTACAGGTTCCGCCATCTCCAAGCAGCAGTGCACTGTCATCAACATCGGCGACCCGGATGGCCCTCCTCGG
CTGGTGGGTCCGATTGGTCGAGCATCTTATTGACGGTCCATCCGCTGACGGAAGCTGTCCCAGATCTCATACCTG
TCGTCGAGCCAAGGCTTTGCCTGGAACCCTGGTAGGCGGACGCCGCATCACGCCCAGCTTTTGCTGACGCGAGTG
TACATAGAAATCTTCCTCCCGAACCACGTCGACTGCGACTACGAACCGCTCGAAAACCAGTGCGAACCGGTGCAC
GAGATTGTACTGAGCGACGAGGAGTCGACCAATCTTCTTCCTCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail